| UniProt ID | GIS2_YEAST | |
|---|---|---|
| UniProt AC | P53849 | |
| Protein Name | Zinc finger protein GIS2 | |
| Gene Name | GIS2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 153 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | May act in the sexual differentiation pathway.. | |
| Protein Sequence | MSQKACYVCGKIGHLAEDCDSERLCYNCNKPGHVQTDCTMPRTVEFKQCYNCGETGHVRSECTVQRCFNCNQTGHISRECPEPKKTSRFSKVSCYKCGGPNHMAKDCMKEDGISGLKCYTCGQAGHMSRDCQNDRLCYNCNETGHISKDCPKA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 30 | Ubiquitination | RLCYNCNKPGHVQTD CCCCCCCCCCCCCCC | 55.35 | 23749301 | |
| 47 | Acetylation | MPRTVEFKQCYNCGE CCCEEEEEECCCCCC | 26.42 | 24489116 | |
| 47 | Ubiquitination | MPRTVEFKQCYNCGE CCCEEEEEECCCCCC | 26.42 | 23749301 | |
| 73 | Phosphorylation | RCFNCNQTGHISREC ECCCCCCCCCCCCCC | 19.41 | 23749301 | |
| 91 | Acetylation | KKTSRFSKVSCYKCG CCCCCCEEEEEEECC | 35.14 | 25381059 | |
| 91 | Ubiquitination | KKTSRFSKVSCYKCG CCCCCCEEEEEEECC | 35.14 | 23749301 | |
| 93 | Phosphorylation | TSRFSKVSCYKCGGP CCCCEEEEEEECCCC | 18.57 | 23749301 | |
| 96 | Ubiquitination | FSKVSCYKCGGPNHM CEEEEEEECCCCCHH | 30.63 | 23749301 | |
| 105 | Acetylation | GGPNHMAKDCMKEDG CCCCHHHHHHHHHHC | 43.83 | 25381059 | |
| 109 | Acetylation | HMAKDCMKEDGISGL HHHHHHHHHHCCCCC | 60.01 | 24489116 | |
| 114 | Phosphorylation | CMKEDGISGLKCYTC HHHHHCCCCCEEEEC | 43.53 | 23749301 | |
| 148 | Acetylation | NETGHISKDCPKA-- CCCCCCCCCCCCC-- | 63.85 | 25381059 | |
| 148 | Ubiquitination | NETGHISKDCPKA-- CCCCCCCCCCCCC-- | 63.85 | 17644757 | |
| 152 | Ubiquitination | HISKDCPKA------ CCCCCCCCC------ | 73.40 | 17644757 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GIS2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GIS2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GIS2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
