UniProt ID | ERP6_YEAST | |
---|---|---|
UniProt AC | P53198 | |
Protein Name | Protein ERP6 | |
Gene Name | ERP6 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 216 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type I membrane protein. |
|
Protein Description | Involved in vesicular protein trafficking.. | |
Protein Sequence | MLSHYIFLAFVLLPFRVSAFYFYGYGGDRKCFLKELSKDTLLKGSYNLEVYDDKLADYALPSYNDYGIVIDVEEVFDNNHRVVHQQGSPSGDFSFLALESGEYKICLQSRVNNWVGKTKTKLEIEFEVGFEAMLDMQRKETLESLHGKVSILNSKIVDIRREQQLMREREESFRDISESVNSRAMWWTVTQVTLLIIICVWQMKSLRSFFVKQKVL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ERP6_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ERP6_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ERP6_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TMEDA_YEAST | ERV25 | physical | 18467557 | |
ERP4_YEAST | ERP4 | physical | 18467557 | |
TMEDA_YEAST | ERV25 | physical | 22615397 | |
EMP24_YEAST | EMP24 | physical | 24217251 | |
TMEDA_YEAST | ERV25 | physical | 24217251 | |
ERP1_YEAST | ERP1 | physical | 24217251 | |
ERP3_YEAST | ERP3 | physical | 24217251 | |
ERP2_YEAST | ERP2 | physical | 24217251 | |
ERP4_YEAST | ERP4 | physical | 24217251 | |
ERP5_YEAST | ERP5 | physical | 24217251 | |
CND2_YEAST | BRN1 | genetic | 27708008 | |
POP7_YEAST | POP7 | genetic | 27708008 | |
FAL1_YEAST | FAL1 | genetic | 27708008 | |
CDC1_YEAST | CDC1 | genetic | 27708008 | |
MOB2_YEAST | MOB2 | genetic | 27708008 | |
ARP4_YEAST | ARP4 | genetic | 27708008 | |
PRI2_YEAST | PRI2 | genetic | 27708008 | |
EI2BB_YEAST | GCD7 | genetic | 27708008 | |
MCM1_YEAST | MCM1 | genetic | 27708008 | |
DCP2_YEAST | DCP2 | genetic | 27708008 | |
NOG2_YEAST | NOG2 | genetic | 27708008 | |
SGT1_YEAST | SGT1 | genetic | 27708008 | |
TOA1_YEAST | TOA1 | genetic | 27708008 | |
NAB3_YEAST | NAB3 | genetic | 27708008 | |
RPN7_YEAST | RPN7 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...