| UniProt ID | POP7_YEAST | |
|---|---|---|
| UniProt AC | P38291 | |
| Protein Name | Ribonucleases P/MRP protein subunit POP7 | |
| Gene Name | POP7 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 140 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of RNase MRP, which cleaves pre-rRNA sequences.. | |
| Protein Sequence | MALKKNTHNKSTKRVTKHPSLKTLTHKQIHTTIFVKSTTPYVSALKRINKFLDSVHKQGSSYVAVLGMGKAVEKTLALGCHFQDQKNKKIEVYTKTIEVLDEVITEGQADIDMESDVEDDDKETQLKKRAVSGVELRIYV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 17 | Acetylation | KSTKRVTKHPSLKTL CCCCCCCCCCCHHCC | 51.14 | 25381059 | |
| 22 | Acetylation | VTKHPSLKTLTHKQI CCCCCCHHCCCCCEE | 45.91 | 25381059 | |
| 31 | Phosphorylation | LTHKQIHTTIFVKST CCCCEECEEEEECCC | 24.18 | 19823750 | |
| 32 | Phosphorylation | THKQIHTTIFVKSTT CCCEECEEEEECCCC | 9.77 | 19823750 | |
| 37 | Phosphorylation | HTTIFVKSTTPYVSA CEEEEECCCCHHHHH | 32.01 | 19823750 | |
| 38 | Phosphorylation | TTIFVKSTTPYVSAL EEEEECCCCHHHHHH | 26.52 | 19823750 | |
| 39 | Phosphorylation | TIFVKSTTPYVSALK EEEECCCCHHHHHHH | 21.51 | 19823750 | |
| 41 | Phosphorylation | FVKSTTPYVSALKRI EECCCCHHHHHHHHH | 12.63 | 19823750 | |
| 43 | Phosphorylation | KSTTPYVSALKRINK CCCCHHHHHHHHHHH | 23.26 | 19823750 | |
| 115 | Phosphorylation | QADIDMESDVEDDDK CCCCCCCCCCCCCCH | 40.08 | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of POP7_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of POP7_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of POP7_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-115, AND MASSSPECTROMETRY. | |
