| UniProt ID | RU1C_YEAST | |
|---|---|---|
| UniProt AC | Q05900 | |
| Protein Name | U1 small nuclear ribonucleoprotein C {ECO:0000255|HAMAP-Rule:MF_03153} | |
| Gene Name | YHC1 {ECO:0000255|HAMAP-Rule:MF_03153} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 231 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Component of the spliceosomal U1 snRNP, which is essential for recognition of the pre-mRNA 5' splice-site and the subsequent assembly of the spliceosome. YHC1/U1-C is directly involved in initial 5' splice-site recognition for both constitutive and regulated alternative splicing. The interaction with the 5' splice-site seems to precede base-pairing between the pre-mRNA and the U1 snRNA. Stimulates commitment or early (E) complex formation by stabilizing the base pairing of the 5' end of the U1 snRNA and the 5' splice-site region.. | |
| Protein Sequence | MTRYYCEYCHSYLTHDTLSVRKSHLVGKNHLRITADYYRNKARDIINKHNHKRRHIGKRGRKERENSSQNETLKVTCLSNKEKRHIMHVKKMNQKELAQTSIDTLKLLYDGSPGYSKVFVDANRFDIGDLVKASKLPQRANEKSAHHSFKQTSRSRDETCESNPFPRLNNPKKLEPPKILSQWSNTIPKTSIFYSVDILQTTIKESKKRMHSDGIRKPSSANGYKRRRYGN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MTRYYCEYC ------CCCCHHHHH | 27.64 | 30377154 | |
| 4 | Phosphorylation | ----MTRYYCEYCHS ----CCCCHHHHHHH | 11.87 | 30377154 | |
| 11 | Phosphorylation | YYCEYCHSYLTHDTL CHHHHHHHHCCCCCC | 20.48 | 30377154 | |
| 14 | Phosphorylation | EYCHSYLTHDTLSVR HHHHHHCCCCCCHHH | 14.96 | 30377154 | |
| 17 | Phosphorylation | HSYLTHDTLSVRKSH HHHCCCCCCHHHHHH | 17.21 | 30377154 | |
| 19 | Phosphorylation | YLTHDTLSVRKSHLV HCCCCCCHHHHHHHC | 23.20 | 30377154 | |
| 148 | Phosphorylation | NEKSAHHSFKQTSRS CHHHHCHHHHHCCCC | 25.03 | 30377154 | |
| 212 | Phosphorylation | ESKKRMHSDGIRKPS HHHHHHHCCCCCCCC | 28.34 | 30377154 | |
| 219 | Phosphorylation | SDGIRKPSSANGYKR CCCCCCCCCCCCCCC | 45.15 | 30377154 | |
| 220 | Phosphorylation | DGIRKPSSANGYKRR CCCCCCCCCCCCCCC | 33.99 | 27214570 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RU1C_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RU1C_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RU1C_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
