| UniProt ID | RSMB_YEAST | |
|---|---|---|
| UniProt AC | P40018 | |
| Protein Name | Small nuclear ribonucleoprotein-associated protein B | |
| Gene Name | SMB1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 196 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Involved in pre-mRNA splicing. Binds snRNA U1, U2, U4 and U5 which contain a highly conserved structural motif called the Sm binding site.. | |
| Protein Sequence | MSKIQVAHSSRLANLIDYKLRVLTQDGRVYIGQLMAFDKHMNLVLNECIEERVPKTQLDKLRPRKDSKDGTTLNIKVEKRVLGLTILRGEQILSTVVEDKPLLSKKERLVRDKKEKKQAQKQTKLRKEKEKKPGKIAKPNTANAKHTSSNSREIAQPSSSRYNGGNDNIGANRSRFNNEAPPQTRKFQPPPGFKRK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Acetylation | -----MSKIQVAHSS -----CCCCCCCCHH | 35.54 | 22865919 | |
| 60 | Acetylation | VPKTQLDKLRPRKDS CCHHHHHHHCCCCCC | 55.79 | 24489116 | |
| 67 | Phosphorylation | KLRPRKDSKDGTTLN HHCCCCCCCCCCEEE | 35.36 | 30377154 | |
| 100 | Acetylation | LSTVVEDKPLLSKKE HHHHHCCCCCCCHHH | 24.86 | 24489116 | |
| 138 | Methylation | KKPGKIAKPNTANAK CCCCCCCCCCCCCCC | 42.12 | 20137074 | |
| 145 | Methylation | KPNTANAKHTSSNSR CCCCCCCCCCCCCCC | 47.42 | 20137074 | |
| 145 | Acetylation | KPNTANAKHTSSNSR CCCCCCCCCCCCCCC | 47.42 | 25381059 | |
| 149 | Phosphorylation | ANAKHTSSNSREIAQ CCCCCCCCCCCCCCC | 39.72 | 21082442 | |
| 159 | Phosphorylation | REIAQPSSSRYNGGN CCCCCCCCCCCCCCC | 26.05 | 30377154 | |
| 186 | Acetylation | EAPPQTRKFQPPPGF CCCCCCCCCCCCCCC | 52.30 | 25381059 | |
| 194 | Acetylation | FQPPPGFKRK----- CCCCCCCCCC----- | 66.25 | 25381059 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RSMB_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RSMB_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RSMB_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
