UniProt ID | SNU23_YEAST | |
---|---|---|
UniProt AC | Q12368 | |
Protein Name | 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component | |
Gene Name | SNU23 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 194 | |
Subcellular Localization | Nucleus . | |
Protein Description | Participates in pre-mRNA splicing. Part of the U4/U5/U6 tri-snRNP complex, one of the building blocks of the spliceosome.. | |
Protein Sequence | MSNFGRRTWDREEYAEQARSGYDDRSLKATLTPIELQALKSKYTNYDHLIKGSLKDLNKRKLTANTESLSSFKRGKKFGFYCDICNLTFKDTLQYIDHLNHKVHAIKFENLFDEPLIIDIRDNDDVPQEEFELCYHNLIKDFVEVRSMETQSKRKRLLDTDVEKAKKVATKPSIESESKVSQMMGFSNFATSKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
73 | Acetylation | TESLSSFKRGKKFGF HHHHHHHHCCCCCEE | 63.29 | 25381059 | |
164 | Acetylation | LLDTDVEKAKKVATK HHHCHHHHHHHHCCC | 66.41 | 25381059 | |
170 | Phosphorylation | EKAKKVATKPSIESE HHHHHHCCCCCCCCH | 46.61 | 29136822 | |
173 | Phosphorylation | KKVATKPSIESESKV HHHCCCCCCCCHHHH | 40.31 | 29136822 | |
176 | Phosphorylation | ATKPSIESESKVSQM CCCCCCCCHHHHHHH | 45.56 | 29136822 | |
178 | Phosphorylation | KPSIESESKVSQMMG CCCCCCHHHHHHHHC | 47.86 | 29136822 | |
181 | Phosphorylation | IESESKVSQMMGFSN CCCHHHHHHHHCCCC | 18.98 | 29136822 | |
187 | Phosphorylation | VSQMMGFSNFATSKK HHHHHCCCCCCCCCC | 25.88 | 29136822 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SNU23_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SNU23_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SNU23_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...