| UniProt ID | BUD31_YEAST | |
|---|---|---|
| UniProt AC | P25337 | |
| Protein Name | Pre-mRNA-splicing factor BUD31 | |
| Gene Name | BUD31 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 157 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Involved in pre-mRNA splicing. Important for bud site selection.. | |
| Protein Sequence | MPRIKTRRSKPAPDGFEKIKPTLTDFEIQLRDAQKDKSSKLAAKSNEQLWEIMQLHHQRSRYIYTLYYKRKAISKDLYDWLIKEKYADKLLIAKWRKTGYEKLCCLRCIQKNETNNGSTCICRVPRAQLEEEARKKGTQVSFHQCVHCGCRGCASTD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 83 | Acetylation | DLYDWLIKEKYADKL HHHHHHHHHHHHHHH | 46.08 | 24489116 | |
| 89 | Acetylation | IKEKYADKLLIAKWR HHHHHHHHHHHHHHH | 36.70 | 24489116 | |
| 94 | Acetylation | ADKLLIAKWRKTGYE HHHHHHHHHHHCCCH | 40.30 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BUD31_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BUD31_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BUD31_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PRP8_YEAST | PRP8 | physical | 15303280 | |
| BRR2_YEAST | BRR2 | physical | 15303280 | |
| PRP22_YEAST | PRP22 | physical | 15303280 | |
| CDC13_YEAST | CDC13 | physical | 15303280 | |
| SN114_YEAST | SNU114 | physical | 15303280 | |
| PABP_YEAST | PAB1 | physical | 15303280 | |
| PRP19_YEAST | PRP19 | physical | 15303280 | |
| ATPA_YEAST | ATP1 | physical | 15303280 | |
| MDHM_YEAST | MDH1 | physical | 15303280 | |
| MAM33_YEAST | MAM33 | physical | 15303280 | |
| BUD31_YEAST | BUD31 | physical | 15303280 | |
| RM03_YEAST | MRPL3 | physical | 15303280 | |
| RM17_YEAST | MRPL17 | physical | 15303280 | |
| MED7_YEAST | MED7 | physical | 18719252 | |
| URN1_YEAST | URN1 | physical | 18719252 | |
| SRS2_YEAST | SRS2 | genetic | 21459050 | |
| KATL1_HUMAN | KATNAL1 | physical | 27107014 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
