RM03_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RM03_YEAST
• UniProt AC: P36516
• Protein Name: 54S ribosomal protein L3, mitochondrial
• Gene Name: MRPL3
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 390
• Subcellular Localization: Mitochondrion . Mitoribosomes are tethered to the mitochondrial inner membrane and spatially aligned with the membrane insertion machinery through two distinct membrane contact sites, formed by the 21S rRNA expansion segment 96-ES1 and the inner memb
• Protein Description: Component of the mitochondrial ribosome (mitoribosome), a dedicated translation machinery responsible for the synthesis of mitochondrial genome-encoded proteins, including at least some of the essential transmembrane subunits of the mitochondrial respiratory chain. The mitoribosomes are attached to the mitochondrial inner membrane and translation products are cotranslationally integrated into the membrane..
• Protein Sequence: MGIVLKRAIAAGMKPFPNSTWHWSRTIRPFSQHLSSTCFLQQSSRFTSKRYLHLSTLTQQEKRFLPESELAKYKEYYQGLKSTVNEIPESVASKSPSLRTLHKRLQLPNELTYSTLSRCLTCPSAKLPDKINNPTKGAAFVNTVPTNKYLDNHGLNIMGKNLLSYHVTKSIIQKYPRLPTVVLNAAVNAYISEAVLAHIAKYWGIEVETTSVLSRYLKMEPFEFTLGRLKFFNNSLNSKDGIELITGKNFSETSALAMSVRSIIAAIWAVTEQKDSQAVYRFIDDHIMSRKLDITKMFQFEQPTRELAMLCRREGLEKPVSKLVAESGRLSKSPVFIVHVFSGEETLGEGYGSSLKEAKARAATDALMKWYCYEPLAQQEPVIDPGTVVV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
58	Phosphorylation	YLHLSTLTQQEKRFL EEEHHHCCHHHHHHC	28.44	24930733
82	Phosphorylation	EYYQGLKSTVNEIPE HHHHHHHHHHHHCCH	42.50	22369663
83	Phosphorylation	YYQGLKSTVNEIPES HHHHHHHHHHHCCHH	26.26	22369663
90	Phosphorylation	TVNEIPESVASKSPS HHHHCCHHHHCCCCC	20.03	22369663
93	Phosphorylation	EIPESVASKSPSLRT HCCHHHHCCCCCHHH	31.35	22369663
148	Acetylation	VNTVPTNKYLDNHGL EECCCCCHHCCCCCC	50.06	24489116
149	Phosphorylation	NTVPTNKYLDNHGLN ECCCCCHHCCCCCCC	22.74	27214570
160	Acetylation	HGLNIMGKNLLSYHV CCCCCCCCHHHHHHC	27.35	24489116
164	Phosphorylation	IMGKNLLSYHVTKSI CCCCHHHHHHCHHHH	19.16	19823750
165	Phosphorylation	MGKNLLSYHVTKSII CCCHHHHHHCHHHHH	10.57	19823750
168	Phosphorylation	NLLSYHVTKSIIQKY HHHHHHCHHHHHHHC	13.03	19823750
239	Acetylation	FNNSLNSKDGIELIT CCCCCCCCCCEEEEC	59.92	24489116
254	Phosphorylation	GKNFSETSALAMSVR CCCCCHHHHHHHHHH	19.75	19779198
327	Phosphorylation	VSKLVAESGRLSKSP HHHHHHHHCCCCCCC	21.34	19823750
331	Phosphorylation	VAESGRLSKSPVFIV HHHHCCCCCCCEEEE	29.72	19823750
353	Phosphorylation	TLGEGYGSSLKEAKA CCCCCCCCCHHHHHH	24.82	27017623

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RM03_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RM03_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RM03_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TVP15_YEAST	TVP15	physical	18719252
PEX29_YEAST	PEX29	physical	18719252
YG35_YEAST	YGR125W	physical	18719252
ATPA_YEAST	ATP1	genetic	27811238

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.