UniProt ID | CGR1_YEAST | |
---|---|---|
UniProt AC | P53188 | |
Protein Name | rRNA-processing protein CGR1 | |
Gene Name | CGR1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 120 | |
Subcellular Localization | Nucleus, nucleolus . | |
Protein Description | Involved in nucleolar integrity and required for processing of the pre-rRNA for the 60S ribosome subunit.. | |
Protein Sequence | MVNETGESQKAAKGTPVSGKVWKAEKTPLRAKSRVVKNKKLTSWELKKQKRLEDKQFKERLKALKDEKEEARQAKITMLKERREKKEENERYERLAAKMHAKKVERMRRREKRNKALKER | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
13 | Acetylation | GESQKAAKGTPVSGK CCCCCCCCCCCCCCC | 69.08 | 25381059 | |
20 | Acetylation | KGTPVSGKVWKAEKT CCCCCCCCCCCCCCC | 37.10 | 25381059 | |
23 | Acetylation | PVSGKVWKAEKTPLR CCCCCCCCCCCCCCC | 50.05 | 25381059 | |
26 | Acetylation | GKVWKAEKTPLRAKS CCCCCCCCCCCCCCH | 61.37 | 25381059 | |
65 | Acetylation | KERLKALKDEKEEAR HHHHHHHHHHHHHHH | 69.56 | 25381059 | |
68 | Acetylation | LKALKDEKEEARQAK HHHHHHHHHHHHHHH | 71.62 | 24489116 | |
98 | Acetylation | RYERLAAKMHAKKVE HHHHHHHHHHHHHHH | 26.13 | 25381059 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CGR1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CGR1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CGR1_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
EBP2_YEAST | EBP2 | physical | 18467557 | |
RRS1_YEAST | RRS1 | physical | 18467557 | |
UPF3_YEAST | UPF3 | genetic | 19061648 | |
RRP8_YEAST | RRP8 | genetic | 19061648 | |
RS8A_YEAST | RPS8A | genetic | 19061648 | |
RS8B_YEAST | RPS8A | genetic | 19061648 | |
IF2A_YEAST | SUI2 | genetic | 19061648 | |
LTV1_YEAST | LTV1 | genetic | 19061648 | |
FKBP_YEAST | FPR1 | genetic | 19061648 | |
YAP6_YEAST | YAP6 | physical | 22875988 | |
LOC1_YEAST | LOC1 | physical | 25877921 | |
NSA2_YEAST | NSA2 | physical | 25877921 | |
EBP2_YEAST | EBP2 | physical | 25877921 | |
NOP4_YEAST | NOP4 | physical | 25877921 | |
MAK21_YEAST | MAK21 | physical | 25877921 | |
RPF2_YEAST | RPF2 | genetic | 27811238 | |
NOP4_YEAST | NOP4 | physical | 27077951 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...