UniProt ID | RRS1_YEAST | |
---|---|---|
UniProt AC | Q08746 | |
Protein Name | Regulator of ribosome biosynthesis | |
Gene Name | RRS1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 203 | |
Subcellular Localization | Nucleus . | |
Protein Description | Required for ribosome biogenesis.. | |
Protein Sequence | MSAEDYKNLPVTVEKPIPVVYDLGNLAAFDSNVLDKNDLDSSNARREEKIKSLTRDNVQLLINQLLSLPMKTTTESVGGTGGQSSVMTLLQLPDPTTDLPREKPLPKAKAMTKWEKFAAKKGIKPKERAGKMIYDEASGEWVPKWGYKGANKKLDDQWLVEVDDKVKGTDNELIDPRTLNRAERKRLVKKNEKQQRRNMKNAL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
113 | Acetylation | PKAKAMTKWEKFAAK CHHHHHHHHHHHHHH | 40.03 | 24489116 | |
116 | Acetylation | KAMTKWEKFAAKKGI HHHHHHHHHHHHCCC | 38.91 | 25381059 | |
131 | Acetylation | KPKERAGKMIYDEAS CHHHHCCCEEEECCC | 22.57 | 24489116 | |
144 | Acetylation | ASGEWVPKWGYKGAN CCCCCCCCCCCCCCC | 43.56 | 24489116 | |
148 | Acetylation | WVPKWGYKGANKKLD CCCCCCCCCCCCCCC | 47.83 | 25381059 | |
152 | Acetylation | WGYKGANKKLDDQWL CCCCCCCCCCCCCEE | 54.93 | 25381059 | |
169 | Phosphorylation | VDDKVKGTDNELIDP ECCCCCCCCCCCCCH | 29.90 | 24961812 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RRS1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RRS1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RRS1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...