| UniProt ID | RL11A_YEAST | |
|---|---|---|
| UniProt AC | P0C0W9 | |
| Protein Name | 60S ribosomal protein L11-A {ECO:0000303|PubMed:9559554} | |
| Gene Name | RPL11A {ECO:0000303|PubMed:9559554} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 174 | |
| Subcellular Localization | Cytoplasm . Nucleus . The SYO1-uL5-uL18 complex is transported into the nucleus by KAP104. | |
| Protein Description | Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel.. | |
| Protein Sequence | MSAKAQNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVRTFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFGIDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTTKEDTVSWFKQKYDADVLDK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSAKAQNPM ------CCCCCCCCC | 38.18 | 10601260 | |
| 4 | Succinylation | ----MSAKAQNPMRD ----CCCCCCCCCHH | 43.10 | 23954790 | |
| 22 | Phosphorylation | EKLVLNISVGESGDR EEEEEECCCCCCHHH | 24.01 | 17287358 | |
| 26 | Phosphorylation | LNISVGESGDRLTRA EECCCCCCHHHHHHH | 39.81 | 17287358 | |
| 31 | Phosphorylation | GESGDRLTRASKVLE CCCHHHHHHHHHHHH | 25.69 | 17287358 | |
| 35 | Ubiquitination | DRLTRASKVLEQLSG HHHHHHHHHHHHHCC | 50.26 | 23749301 | |
| 35 | Acetylation | DRLTRASKVLEQLSG HHHHHHHHHHHHHCC | 50.26 | 24489116 | |
| 35 | 2-Hydroxyisobutyrylation | DRLTRASKVLEQLSG HHHHHHHHHHHHHCC | 50.26 | - | |
| 41 | Phosphorylation | SKVLEQLSGQTPVQS HHHHHHHCCCCCCCC | 28.66 | 21440633 | |
| 44 | Phosphorylation | LEQLSGQTPVQSKAR HHHHCCCCCCCCCEE | 29.02 | 25752575 | |
| 48 | Phosphorylation | SGQTPVQSKARYTVR CCCCCCCCCEEEEEE | 28.63 | 11283598 | |
| 49 | Ubiquitination | GQTPVQSKARYTVRT CCCCCCCCEEEEEEE | 21.57 | 23749301 | |
| 49 | Acetylation | GQTPVQSKARYTVRT CCCCCCCCEEEEEEE | 21.57 | 24489116 | |
| 49 | 2-Hydroxyisobutyrylation | GQTPVQSKARYTVRT CCCCCCCCEEEEEEE | 21.57 | - | |
| 53 | Phosphorylation | VQSKARYTVRTFGIR CCCCEEEEEEEECCC | 9.65 | 17287358 | |
| 56 | Phosphorylation | KARYTVRTFGIRRNE CEEEEEEEECCCCCC | 23.13 | 17287358 | |
| 64 | Acetylation | FGIRRNEKIAVHVTV ECCCCCCEEEEEEEE | 39.24 | 22865919 | |
| 75 | "N6,N6,N6-trimethyllysine" | HVTVRGPKAEEILER EEEECCCCHHHHHHH | 71.85 | - | |
| 75 | Succinylation | HVTVRGPKAEEILER EEEECCCCHHHHHHH | 71.85 | 23954790 | |
| 75 | Methylation | HVTVRGPKAEEILER EEEECCCCHHHHHHH | 71.85 | 22522802 | |
| 75 | Acetylation | HVTVRGPKAEEILER EEEECCCCHHHHHHH | 71.85 | 22865919 | |
| 75 | Ubiquitination | HVTVRGPKAEEILER EEEECCCCHHHHHHH | 71.85 | 23749301 | |
| 85 | Ubiquitination | EILERGLKVKEYQLR HHHHHCCCEEEEECC | 54.83 | 22817900 | |
| 87 | Succinylation | LERGLKVKEYQLRDR HHHCCCEEEEECCCC | 49.47 | 23954790 | |
| 87 | 2-Hydroxyisobutyrylation | LERGLKVKEYQLRDR HHHCCCEEEEECCCC | 49.47 | - | |
| 87 | Ubiquitination | LERGLKVKEYQLRDR HHHCCCEEEEECCCC | 49.47 | 23749301 | |
| 142 | Ubiquitination | GARVTRRKRCKGTVG CCCCCCCCCCCCCCC | 59.88 | 22817900 | |
| 145 | Acetylation | VTRRKRCKGTVGNSH CCCCCCCCCCCCCCC | 62.74 | 25381059 | |
| 145 | Ubiquitination | VTRRKRCKGTVGNSH CCCCCCCCCCCCCCC | 62.74 | 22817900 | |
| 151 | Phosphorylation | CKGTVGNSHKTTKED CCCCCCCCCCCCCHH | 22.04 | 27214570 | |
| 153 | Ubiquitination | GTVGNSHKTTKEDTV CCCCCCCCCCCHHHH | 58.68 | 22817900 | |
| 153 | 2-Hydroxyisobutyrylation | GTVGNSHKTTKEDTV CCCCCCCCCCCHHHH | 58.68 | - | |
| 156 | Succinylation | GNSHKTTKEDTVSWF CCCCCCCCHHHHHHH | 59.84 | 23954790 | |
| 156 | Ubiquitination | GNSHKTTKEDTVSWF CCCCCCCCHHHHHHH | 59.84 | 22817900 | |
| 156 | Acetylation | GNSHKTTKEDTVSWF CCCCCCCCHHHHHHH | 59.84 | 24489116 | |
| 156 | 2-Hydroxyisobutyrylation | GNSHKTTKEDTVSWF CCCCCCCCHHHHHHH | 59.84 | - | |
| 159 | Phosphorylation | HKTTKEDTVSWFKQK CCCCCHHHHHHHHHH | 19.96 | 28889911 | |
| 161 | Phosphorylation | TTKEDTVSWFKQKYD CCCHHHHHHHHHHHC | 28.96 | 22369663 | |
| 164 | Succinylation | EDTVSWFKQKYDADV HHHHHHHHHHHCCCC | 39.35 | 23954790 | |
| 164 | Acetylation | EDTVSWFKQKYDADV HHHHHHHHHHHCCCC | 39.35 | 24489116 | |
| 164 | Ubiquitination | EDTVSWFKQKYDADV HHHHHHHHHHHCCCC | 39.35 | 23749301 | |
| 164 | 2-Hydroxyisobutyrylation | EDTVSWFKQKYDADV HHHHHHHHHHHCCCC | 39.35 | - | |
| 166 | Succinylation | TVSWFKQKYDADVLD HHHHHHHHHCCCCCC | 45.76 | 23954790 | |
| 166 | Ubiquitination | TVSWFKQKYDADVLD HHHHHHHHHCCCCCC | 45.76 | 23749301 | |
| 166 | Acetylation | TVSWFKQKYDADVLD HHHHHHHHHCCCCCC | 45.76 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL11A_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL11A_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL11A_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "The action of N-terminal acetyltransferases on yeast ribosomalproteins."; Arnold R.J., Polevoda B., Reilly J.P., Sherman F.; J. Biol. Chem. 274:37035-37040(1999). Cited for: CLEAVAGE OF INITIATOR METHIONINE, AND ACETYLATION AT SER-2 BY NATA. | |
| "NH2-terminal acetylation of ribosomal proteins of Saccharomycescerevisiae."; Takakura H., Tsunasawa S., Miyagi M., Warner J.R.; J. Biol. Chem. 267:5442-5445(1992). Cited for: PROTEIN SEQUENCE OF 2-17, AND ACETYLATION AT SER-2 BY NATA. | |
| Phosphorylation | |
| Reference | PubMed |
| "Analysis of phosphorylation sites on proteins from Saccharomycescerevisiae by electron transfer dissociation (ETD) massspectrometry."; Chi A., Huttenhower C., Geer L.Y., Coon J.J., Syka J.E.P., Bai D.L.,Shabanowitz J., Burke D.J., Troyanskaya O.G., Hunt D.F.; Proc. Natl. Acad. Sci. U.S.A. 104:2193-2198(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-22; SER-26 AND THR-31,AND MASS SPECTROMETRY. | |