| UniProt ID | CDC42_YEAST | |
|---|---|---|
| UniProt AC | P19073 | |
| Protein Name | Cell division control protein 42 | |
| Gene Name | CDC42 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 191 | |
| Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
| Protein Description | Involved in development of cell polarity during the cell division cycle, and essential for bud emergence. Affects signaling in the pheromone-response pathway through the STE20 protein kinase. Negatively regulated by the GTPase-activating proteins RGA1, BEM3, and BEM4.. | |
| Protein Sequence | MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLVVGTQIDLRDDKVIIEKLQRQRLRPITSEQGSRLARELKAVKYVECSALTQRGLKNVFDEAIVAALEPPVIKKSKKCAIL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 123 | Ubiquitination | QIDLRDDKVIIEKLQ EEECCCCHHHHHHHH | 39.35 | 23749301 | |
| 128 | 2-Hydroxyisobutyrylation | DDKVIIEKLQRQRLR CCHHHHHHHHHCCCC | 39.24 | - | |
| 128 | Acetylation | DDKVIIEKLQRQRLR CCHHHHHHHHHCCCC | 39.24 | 24489116 | |
| 138 | Phosphorylation | RQRLRPITSEQGSRL HCCCCCCCCHHHHHH | 28.97 | 27214570 | |
| 153 | Ubiquitination | ARELKAVKYVECSAL HHHHHCCCEEECHHH | 48.73 | 23749301 | |
| 153 | Acetylation | ARELKAVKYVECSAL HHHHHCCCEEECHHH | 48.73 | 24489116 | |
| 166 | Ubiquitination | ALTQRGLKNVFDEAI HHHHHHHHHHHCHHH | 54.62 | 17644757 | |
| 183 | Ubiquitination | ALEPPVIKKSKKCAI HHCCCCCCCCCCCCC | 51.75 | 17644757 | |
| 183 | Acetylation | ALEPPVIKKSKKCAI HHCCCCCCCCCCCCC | 51.75 | 24489116 | |
| 184 | Ubiquitination | LEPPVIKKSKKCAIL HCCCCCCCCCCCCCC | 57.28 | 17644757 | |
| 188 | Methylation | VIKKSKKCAIL---- CCCCCCCCCCC---- | 3.06 | - | |
| 188 | Geranylgeranylation | VIKKSKKCAIL---- CCCCCCCCCCC---- | 3.06 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CDC42_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CDC42_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDC42_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
