RS4_DICDI - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RS4_DICDI
• UniProt AC: P51405
• Protein Name: 40S ribosomal protein S4
• Gene Name: rps4
• Organism: Dictyostelium discoideum (Slime mold).
• Sequence Length: 267
• Subcellular Localization: Cytoplasm.
• Protein Sequence: MARGPKKHLKRLAAPNHWMLDKLSGKWAPRPSSGPHKLRECLPLILVLRNRLKYALTKKEVTLILMQRLVKVDGKVRTDPNYPAGFMDVISIEKTKENFRLLFDPKGRFTLQRITPEEAKFKLARVTRVETGNQGIPYVHTDDGRTIRYPDPAISIHDTIKIDIESGKITAFIPFEVNNLCMIVGGHNLGRVGAVTHREKHPGSFDIVHVTDTAGHQFATRLSNVFIIGKASQTFVSLPAGKGVRRSRVDERNAALKRRGEKIETVA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
232	Phosphorylation	VFIIGKASQTFVSLP EEEEEEECCEEEECC	32.99	30612939
234	Phosphorylation	IIGKASQTFVSLPAG EEEEECCEEEECCCC	24.41	30612939

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RS4_DICDI !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RS4_DICDI !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RS4_DICDI !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDC24_YEAST	CDC24	physical	22363460
CDC42_YEAST	CDC42	physical	22363460
CLA4_YEAST	CLA4	physical	22363460
BEM1_YEAST	BEM1	physical	22363460

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.