| UniProt ID | RS4_DICDI | |
|---|---|---|
| UniProt AC | P51405 | |
| Protein Name | 40S ribosomal protein S4 | |
| Gene Name | rps4 | |
| Organism | Dictyostelium discoideum (Slime mold). | |
| Sequence Length | 267 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | ||
| Protein Sequence | MARGPKKHLKRLAAPNHWMLDKLSGKWAPRPSSGPHKLRECLPLILVLRNRLKYALTKKEVTLILMQRLVKVDGKVRTDPNYPAGFMDVISIEKTKENFRLLFDPKGRFTLQRITPEEAKFKLARVTRVETGNQGIPYVHTDDGRTIRYPDPAISIHDTIKIDIESGKITAFIPFEVNNLCMIVGGHNLGRVGAVTHREKHPGSFDIVHVTDTAGHQFATRLSNVFIIGKASQTFVSLPAGKGVRRSRVDERNAALKRRGEKIETVA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS4_DICDI !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS4_DICDI !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS4_DICDI !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CDC24_YEAST | CDC24 | physical | 22363460 | |
| CDC42_YEAST | CDC42 | physical | 22363460 | |
| CLA4_YEAST | CLA4 | physical | 22363460 | |
| BEM1_YEAST | BEM1 | physical | 22363460 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...