UniProt ID | RS4_DICDI | |
---|---|---|
UniProt AC | P51405 | |
Protein Name | 40S ribosomal protein S4 | |
Gene Name | rps4 | |
Organism | Dictyostelium discoideum (Slime mold). | |
Sequence Length | 267 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | ||
Protein Sequence | MARGPKKHLKRLAAPNHWMLDKLSGKWAPRPSSGPHKLRECLPLILVLRNRLKYALTKKEVTLILMQRLVKVDGKVRTDPNYPAGFMDVISIEKTKENFRLLFDPKGRFTLQRITPEEAKFKLARVTRVETGNQGIPYVHTDDGRTIRYPDPAISIHDTIKIDIESGKITAFIPFEVNNLCMIVGGHNLGRVGAVTHREKHPGSFDIVHVTDTAGHQFATRLSNVFIIGKASQTFVSLPAGKGVRRSRVDERNAALKRRGEKIETVA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS4_DICDI !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS4_DICDI !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS4_DICDI !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CDC24_YEAST | CDC24 | physical | 22363460 | |
CDC42_YEAST | CDC42 | physical | 22363460 | |
CLA4_YEAST | CLA4 | physical | 22363460 | |
BEM1_YEAST | BEM1 | physical | 22363460 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...