UniProt ID | RBX1_YEAST | |
---|---|---|
UniProt AC | Q08273 | |
Protein Name | RING-box protein HRT1 | |
Gene Name | HRT1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 121 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Core component of multiple cullin-RING-based E3 ubiquitin-protein ligase complexes (CRLs), which mediate the ubiquitination of target proteins. Recruits the E2 ubiquitin-conjugating enzyme CDC34/UBC3 to the complex and brings it into close proximity to the substrate. Also stimulates CDC34/UBC3 autoubiquitination and promotes the neddylation of CDC53 and RTT101. Component of the SCF(CDC4) ubiquitin ligase required for ubiquitination of the cyclin-dependent kinase inhibitor SIC1 and for the G1-to-S phase transition. Component of the RTT101(MMS1-MMS22) ubiquitin ligase that promotes fork progression through damaged DNA or natural pause sites. Component of the CRL3(ELA1) ubiquitin ligase required for ubiquitinaton of RPB1, the largest subunit of RNA polymerase II (Pol II), which targets Pol II for proteasomal degradation in DNA-damaged cells.. | |
Protein Sequence | MSNEVDRMDVDEDESQNIAQSSNQSAPVETKKKRFEIKKWTAVAFWSWDIAVDNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKTRDACPLDNQPWQLARCGR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
15 | Phosphorylation | MDVDEDESQNIAQSS CCCCHHHHHHHHHHC | 40.63 | 28889911 | |
25 | Phosphorylation | IAQSSNQSAPVETKK HHHHCCCCCCCCCHH | 38.50 | 27017623 | |
30 | Phosphorylation | NQSAPVETKKKRFEI CCCCCCCCHHHHHHE | 48.69 | 27017623 | |
31 | Ubiquitination | QSAPVETKKKRFEIK CCCCCCCHHHHHHEE | 42.67 | 22106047 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RBX1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RBX1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RBX1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...