dbPTM

UBC5_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	UBC5_YEAST
UniProt AC	P15732
Protein Name	Ubiquitin-conjugating enzyme E2-16 kDa
Gene Name	UBC5
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	148
Subcellular Localization
Protein Description	Catalyzes the covalent attachment of ubiquitin to other proteins. Mediates the selective degradation of short-lived and abnormal proteins..
Protein Sequence	MSSSKRIAKELSDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTKIYHPNINSSGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKTDKAKYEATAKEWTKKYAV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
12	Phosphorylation	KRIAKELSDLGRDPP HHHHHHHHHCCCCCC	31.70	-
91	Ubiquitination	NICLDILKDQWSPAL CCHHHHHCCCCCHHH	48.48	23749301

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of UBC5_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of UBC5_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of UBC5_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NACB1_YEAST	EGD1	physical	16926149
NACA_YEAST	EGD2	physical	16926149
NOT4_YEAST	MOT2	physical	16926149
UBC4_YEAST	UBC4	genetic	17314980
PLPHP_YEAST	YBL036C	genetic	17314980
NOT2_YEAST	CDC36	genetic	17314980
RPB1_YEAST	RPO21	physical	17418786
ASR1_YEAST	ASR1	physical	18719252
UBC1_YEAST	UBC1	genetic	20598539
HUL5_YEAST	HUL5	physical	21983566
CNOT4_HUMAN	CNOT4	physical	11823428
NOT4_YEAST	MOT2	physical	11823428
UBC1_YEAST	UBC1	genetic	2265617
LCF1_YEAST	FAA1	genetic	23891562
UBC6_YEAST	UBC6	genetic	23583075
UBC7_YEAST	UBC7	genetic	23583075
UBC4_YEAST	UBC4	genetic	8565073
RPB2_YEAST	RPB2	physical	17418786
RSP5_YEAST	RSP5	physical	17418786
RAD53_YEAST	RAD53	physical	19578373
H3_YEAST	HHT1	physical	19578373
UBC4_YEAST	UBC4	physical	19578373
ETR1_YEAST	ETR1	genetic	27708008
UBC4_YEAST	UBC4	genetic	27708008
GNTK_YEAST	YDR248C	genetic	27708008
BCS1_YEAST	BCS1	genetic	27708008
BUD27_YEAST	BUD27	genetic	27708008
VMA21_YEAST	VMA21	genetic	27708008
HTD2_YEAST	HTD2	genetic	27708008
DIA2_YEAST	DIA2	genetic	27708008
TRAF6_HUMAN	TRAF6	physical	27107014
TRI39_HUMAN	TRIM39	physical	27107014
TRIM1_HUMAN	MID2	physical	27107014

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of UBC5_YEAST

Related Literatures of Post-Translational Modification