| UniProt ID | UBC4_YEAST | |
|---|---|---|
| UniProt AC | P15731 | |
| Protein Name | Ubiquitin-conjugating enzyme E2 4 | |
| Gene Name | UBC4 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 148 | |
| Subcellular Localization | ||
| Protein Description | Catalyzes the covalent attachment of ubiquitin to other proteins. Mediates the selective degradation of short-lived and abnormal proteins. Mediates ubiquitination of PEX5.. | |
| Protein Sequence | MSSSKRIAKELSDLERDPPTSCSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPKYEATAREWTKKYAV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 9 | Acetylation | SSSKRIAKELSDLER CHHHHHHHHHHHHHC | 57.74 | 24489116 | |
| 12 | Phosphorylation | KRIAKELSDLERDPP HHHHHHHHHHHCCCC | 41.04 | 28889911 | |
| 91 | Ubiquitination | NICLDILKDQWSPAL CEEHHHHHCCCCHHH | 48.48 | 23749301 | |
| 91 | Acetylation | NICLDILKDQWSPAL CEEHHHHHCCCCHHH | 48.48 | 24489116 | |
| 129 | Ubiquitination | PEIAHIYKTDRPKYE HHHHHHEECCCCCCC | 43.26 | 22817900 | |
| 134 | Ubiquitination | IYKTDRPKYEATARE HEECCCCCCCCHHCH | 57.53 | 23749301 | |
| 134 | Acetylation | IYKTDRPKYEATARE HEECCCCCCCCHHCH | 57.53 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UBC4_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UBC4_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBC4_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-12, AND MASSSPECTROMETRY. | |
