SMD1_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SMD1_YEAST
• UniProt AC: Q02260
• Protein Name: Small nuclear ribonucleoprotein Sm D1
• Gene Name: SMD1
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 146
• Subcellular Localization: Nucleus.
• Protein Description: Involved in pre-mRNA splicing. Binds snRNA U1, U2, U4 and U5 which contain a highly conserved structural motif called the Sm binding site. Also binds telomerase RNA and is required for its accumulation..
• Protein Sequence: MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPQPRLNKLNSNGIAMASLYLTGGQQPTASDNIASLQYINIRGNTIRQIILPDSLNLDSLLVDQKQLNSLRRSGQIANDPSKKRRRDFGAPANKRPRRGL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
57	Phosphorylation	PRLNKLNSNGIAMAS HHHHCCCCCCEEEEE	47.04	29136822
64	Phosphorylation	SNGIAMASLYLTGGQ CCCEEEEEEEECCCC	12.40	29136822
66	Phosphorylation	GIAMASLYLTGGQQP CEEEEEEEECCCCCC	10.34	29136822
68	Phosphorylation	AMASLYLTGGQQPTA EEEEEEECCCCCCCC	26.21	29136822
74	Phosphorylation	LTGGQQPTASDNIAS ECCCCCCCCCCCEEE	34.16	29136822
76	Phosphorylation	GGQQPTASDNIASLQ CCCCCCCCCCEEECE	33.40	29136822
81	Phosphorylation	TASDNIASLQYINIR CCCCCEEECEEEECC	16.53	29136822
84	Phosphorylation	DNIASLQYINIRGNT CCEEECEEEECCCCE	10.96	29136822
91	Phosphorylation	YINIRGNTIRQIILP EEECCCCEEEEEECC	21.99	29136822
119	Phosphorylation	QLNSLRRSGQIANDP HHHHHHHHCCCCCCC	28.72	30377154
128	Acetylation	QIANDPSKKRRRDFG CCCCCCCHHHHHCCC	56.54	25381059
140	Acetylation	DFGAPANKRPRRGL- CCCCCCCCCCCCCC-	66.92	25381059

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SMD1_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SMD1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SMD1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RU2A_YEAST	LEA1	physical	11805826
PRP21_YEAST	PRP21	physical	11805826
PRP31_YEAST	PRP31	physical	11805826
PRP39_YEAST	PRP39	physical	11805826
PRP6_YEAST	PRP6	physical	11805826
PRP9_YEAST	PRP9	physical	11805826
RSMB_YEAST	SMB1	physical	11805826
SMD3_YEAST	SMD3	physical	11805826
SN114_YEAST	SNU114	physical	11805826
SNU56_YEAST	SNU56	physical	11805826
XPOT_YEAST	LOS1	physical	9207794
SAC7_YEAST	SAC7	physical	9207794
SLU7_YEAST	SLU7	physical	9207794
QDR3_YEAST	QDR3	physical	9207794
ARO8_YEAST	ARO8	physical	9207794
RAV1_YEAST	RAV1	physical	9207794
PXA2_YEAST	PXA2	physical	9207794
SEC39_YEAST	SEC39	physical	9207794
LHP1_YEAST	LHP1	genetic	10747032
LSM2_YEAST	LSM2	physical	16554755
SNU71_YEAST	SNU71	physical	16554755
PRP40_YEAST	PRP40	physical	16554755
SMD3_YEAST	SMD3	physical	16554755
SMD2_YEAST	SMD2	physical	16554755
RUXE_YEAST	SME1	physical	16554755
RU2A_YEAST	LEA1	physical	16554755
BRR1_YEAST	BRR1	physical	16554755
RUXF_YEAST	SMX3	physical	16554755
BRR2_YEAST	BRR2	physical	16429126
RU2A_YEAST	LEA1	physical	16429126
PRP21_YEAST	PRP21	physical	16429126
PRP31_YEAST	PRP31	physical	16429126
PRP39_YEAST	PRP39	physical	16429126
PRP6_YEAST	PRP6	physical	16429126
PRP8_YEAST	PRP8	physical	16429126
PRP9_YEAST	PRP9	physical	16429126
RSMB_YEAST	SMB1	physical	16429126
SMD3_YEAST	SMD3	physical	16429126
SN114_YEAST	SNU114	physical	16429126
SNU56_YEAST	SNU56	physical	16429126
LOT5_YEAST	LOT5	physical	18719252

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.