| UniProt ID | SMD3_YEAST | |
|---|---|---|
| UniProt AC | P43321 | |
| Protein Name | Small nuclear ribonucleoprotein Sm D3 | |
| Gene Name | SMD3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 101 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Involved in pre-mRNA splicing. Binds snRNA U1, U2, U4 and U5 which contain a highly conserved structural motif called the Sm binding site. Also binds telomerase RNA and is required for its accumulation.. | |
| Protein Sequence | MTMNGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFKKNSSRPMPPIRGPKRR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of SMD3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SMD3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SMD3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SMD3_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RSMB_YEAST | SMB1 | physical | 10428970 | |
| CDC12_YEAST | CDC12 | physical | 9207794 | |
| MTD1_YEAST | MTD1 | physical | 9207794 | |
| REV7_YEAST | REV7 | physical | 9207794 | |
| SEN1_YEAST | SEN1 | physical | 9207794 | |
| SPA2_YEAST | SPA2 | physical | 9207794 | |
| RSMB_YEAST | SMB1 | physical | 9207794 | |
| STB5_YEAST | STB5 | physical | 9207794 | |
| VBA1_YEAST | VBA1 | physical | 9207794 | |
| PP2B1_YEAST | CNA1 | physical | 9207794 | |
| RAD16_YEAST | RAD16 | physical | 9207794 | |
| SNU66_YEAST | SNU66 | physical | 10377396 | |
| PRP6_YEAST | PRP6 | physical | 16554755 | |
| PRP9_YEAST | PRP9 | physical | 16554755 | |
| ARG56_YEAST | ARG5,6 | physical | 16554755 | |
| RSE1_YEAST | RSE1 | physical | 16554755 | |
| RU1A_YEAST | MUD1 | genetic | 24497193 | |
| MUD2_YEAST | MUD2 | genetic | 24497193 | |
| SMD1_YEAST | SMD1 | genetic | 27974620 | |
| SMD2_YEAST | SMD2 | genetic | 27974620 | |
| RUXF_YEAST | SMX3 | genetic | 27417296 | |
| MUD2_YEAST | MUD2 | genetic | 25897024 | |
| RU1A_YEAST | MUD1 | genetic | 25897024 | |
| NAM8_YEAST | NAM8 | genetic | 25897024 | |
| TGS1_YEAST | TGS1 | genetic | 25897024 | |
| RSMB_YEAST | SMB1 | genetic | 25897024 | |
| RU2A_YEAST | LEA1 | genetic | 25897024 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
