| UniProt ID | RUXF_YEAST | |
|---|---|---|
| UniProt AC | P54999 | |
| Protein Name | Small nuclear ribonucleoprotein F | |
| Gene Name | SMX3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 86 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Involved in pre-mRNA splicing. Binds snRNA U1, U2, U4 and U5 which contain a highly conserved structural motif called the Sm binding site.. | |
| Protein Sequence | MSESSDISAMQPVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSESSDISA ------CCCCCCCCC | 46.30 | 22369663 | |
| 4 | Phosphorylation | ----MSESSDISAMQ ----CCCCCCCCCCC | 26.46 | 22369663 | |
| 5 | Phosphorylation | ---MSESSDISAMQP ---CCCCCCCCCCCC | 34.61 | 22369663 | |
| 8 | Phosphorylation | MSESSDISAMQPVNP CCCCCCCCCCCCCCC | 23.76 | 22369663 | |
| 35 | Phosphorylation | GVKLKFNSTEYRGTL CEEEEECCCEEEEEE | 26.25 | 24930733 | |
| 36 | Phosphorylation | VKLKFNSTEYRGTLV EEEEECCCEEEEEEE | 37.83 | 24930733 | |
| 38 | Phosphorylation | LKFNSTEYRGTLVST EEECCCEEEEEEEEC | 17.90 | 24930733 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RUXF_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RUXF_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RUXF_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
