| UniProt ID | UFE1_YEAST | |
|---|---|---|
| UniProt AC | P41834 | |
| Protein Name | Syntaxin UFE1 | |
| Gene Name | UFE1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 346 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type IV membrane protein. |
|
| Protein Description | Syntaxin required for targeting and fusion of Golgi-derived retrograde transport vesicles with the ER.. | |
| Protein Sequence | MMSDLTPIFRKYVAVIDDARNEQNGIDDHVERKQEDFGNSNETCEMFRDSFIKECARLLKFLVELNKVIKQIEKNYLDDFNMSDAEKDEFDMECRLQIQQYFKKFEFLENYEMERHNLSLKRFQSKSHRWSKILSNKNDNTKHVIHPQDIENGVYEFRLGVLRCLNLWIKYVSSKFTTIQQERLILENKMNFNSTPMPTLSNNADDFSADAIDISVSQSAPVETVQDEVKHYEETISKLTQEQLQVLETEHSELLNQKNEQLKKVETINKTILDIVNIQNELSNHLTVQSQNINLMLNNQDDIELNIKKGNKELRKAKRAAGRTAKMTTYGAIIMGVFILFLDYVG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 11 | Ubiquitination | DLTPIFRKYVAVIDD CCHHHHHHHHHHHHH | 33.07 | 23749301 | |
| 119 | Phosphorylation | EMERHNLSLKRFQSK HHHHCCCCHHHHHCC | 36.84 | 15665377 | |
| 201 | Phosphorylation | STPMPTLSNNADDFS CCCCCCCCCCCCCCC | 30.43 | 19779198 | |
| 258 | Ubiquitination | HSELLNQKNEQLKKV HHHHHHHHHHHHHHH | 62.47 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UFE1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UFE1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UFE1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
