| UniProt ID | NIP7_YEAST | |
|---|---|---|
| UniProt AC | Q08962 | |
| Protein Name | 60S ribosome subunit biogenesis protein NIP7 | |
| Gene Name | NIP7 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 181 | |
| Subcellular Localization | Cytoplasm. Nucleus, nucleolus. | |
| Protein Description | Required for proper 27S pre-rRNA processing and 60S ribosome subunit assembly.. | |
| Protein Sequence | MRQLTEEETKVVFEKLAGYIGRNISFLVDNKELPHVFRLQKDRVYYVPDHVAKLATSVARPNLMSLGICLGKFTKTGKFRLHITSLTVLAKHAKYKIWIKPNGEMPFLYGNHVLKAHVGKMSDDIPEHAGVIVFAMNDVPLGFGVSAKSTSESRNMQPTGIVAFRQADIGEYLRDEDTLFT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 15 | Acetylation | ETKVVFEKLAGYIGR HHHHHHHHHHHHCCC | 31.97 | 24489116 | |
| 25 | Phosphorylation | GYIGRNISFLVDNKE HHCCCCEEEEECCCC | 18.97 | 27214570 | |
| 31 | Acetylation | ISFLVDNKELPHVFR EEEEECCCCCCCEEE | 57.05 | 24489116 | |
| 172 | Phosphorylation | RQADIGEYLRDEDTL EECCHHHHHCCCCCC | 11.21 | 29688323 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NIP7_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NIP7_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NIP7_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
