| UniProt ID | MRT4_YEAST | |
|---|---|---|
| UniProt AC | P33201 | |
| Protein Name | Ribosome assembly factor MRT4 {ECO:0000303|PubMed:19346338} | |
| Gene Name | MRT4 {ECO:0000303|PubMed:10471698} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 236 | |
| Subcellular Localization | Nucleus, nucleolus . Cytoplasm . Shuttles between the nucleus and the cytoplasm. | |
| Protein Description | Component of the ribosome assembly machinery. Nuclear paralog of the ribosomal protein P0, it binds pre-60S subunits at an early stage of assembly in the nucleolus, and is replaced by P0 in cytoplasmic pre-60S subunits and mature 80S ribosomes.. | |
| Protein Sequence | MPRSKRSKLVTLAQTDKKGRENKERIFDEVREALDTYRYVWVLHLDDVRTPVLQEIRTSWAGSKLIMGKRKVLQKALGEKREEEYKENLYQLSKLCSGVTGLLFTDEDVNTVKEYFKSYVRSDYSRPNTKAPLTFTIPEGIVYSRGGQIPAEEDVPMIHSLEPTMRNKFEIPTKIKAGKITIDSPYLVCTEGEKLDVRQALILKQFGIAASEFKVKVSAYYDNDSSTVESTNINME | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Acetylation | MPRSKRSKLVTLAQT CCCCHHHHHHHHHHC | 51.51 | 24489116 | |
| 17 | Acetylation | VTLAQTDKKGRENKE HHHHHCCCCCCCHHH | 61.59 | 25381059 | |
| 75 | Acetylation | GKRKVLQKALGEKRE CHHHHHHHHHCHHCH | 41.22 | 22865919 | |
| 117 | Acetylation | NTVKEYFKSYVRSDY HHHHHHHHHHHHCCC | 39.72 | 24489116 | |
| 168 | Acetylation | LEPTMRNKFEIPTKI CCCCCCCCCCCCCCE | 33.73 | 24489116 | |
| 181 | Phosphorylation | KIKAGKITIDSPYLV CEECCCEEECCCEEE | 23.40 | 29734811 | |
| 184 | Phosphorylation | AGKITIDSPYLVCTE CCCEEECCCEEEECC | 16.17 | 21551504 | |
| 194 | Acetylation | LVCTEGEKLDVRQAL EEECCCCCCCHHHHH | 61.93 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MRT4_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MRT4_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MRT4_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-184, AND MASSSPECTROMETRY. | |
