| UniProt ID | STS1_YEAST | |
|---|---|---|
| UniProt AC | P38637 | |
| Protein Name | Tethering factor for nuclear proteasome STS1 | |
| Gene Name | STS1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 319 | |
| Subcellular Localization | Cytoplasm. Nucleus. | |
| Protein Description | Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins. Required for efficient chromosome segregation. Restores protein transport and ribosomal RNA stability.. | |
| Protein Sequence | MMGFEWGFKPSSKITQSTVSSQGTGNVMIPTAGVKQKRRYANEEQEEEELPRNKNVMKYGGVSKRRPQPGSLIRGQPLPLQRGMELMNKNQLQQLLVDLMTKHPEIQQSVHTRVIGLDFSIQKCLDMLKQKSEAVYQSIPYNRSYESNKLDDYAFVRMKPQILEFLNCLVDFILDNIPPRLENLHASLKFLDICTELVIKLPRFELASNNYYYDKCIEQLSHVWCTLIEHVARDRIILLADNSSVWKSHMTRLQVYNEHSNGLLERPLQLFKSLDMGSPSAASSSTLSLQESIIYHHDTMTANENNNNSGSAATDSPFN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 256 | Phosphorylation | HMTRLQVYNEHSNGL HHHHHHHHHHCCCCC | 11.24 | 28132839 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of STS1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of STS1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of STS1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
