| UniProt ID | MOB2_YEAST | |
|---|---|---|
| UniProt AC | P43563 | |
| Protein Name | CBK1 kinase activator protein MOB2 | |
| Gene Name | MOB2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 287 | |
| Subcellular Localization | Nucleus. Cytoplasm. Localizes to the bud cortex during polarized growth and to the bud neck and daughter cell nucleus during late mitosis. | |
| Protein Description | Functions as an activator subunit for the CBK1 protein kinase. Part of the regulation of ACE2 activity and cellular morphogenesis (RAM) signaling network. Required for coordinating polarized cell growth during interphase with the onset of mitosis. Required for mother/daughter cell separation after cytokinesis. Also has a role in the prevention of nuclear export of ACE2 from the daughter cell nucleus after mitotic exit. It coordinates ACE2-dependent transcription with mitotic exit network activation.. | |
| Protein Sequence | MSFFNFKAFGRNSKKNKNQPLNVAQPPAMNTIYSSPHSSNSRLSLRNKHHSPKRHSQTSFPAQKSTPQSQQLTSTTPQSQQQEASERSESQQIMFLSEPFVRTALVKGSFKTIVQLPKYVDLGEWIALNVFEFFTNLNQFYGVVAEYVTPDAYPTMNAGPHTDYLWLDANNRQVSLPASQYIDLALTWINNKVNDKNLFPTKNGLPFPQQFSRDVQRIMVQMFRIFAHIYHHHFDKIVHLSLEAHWNSFFSHFISFAKEFKIIDRKEMAPLLPLIESFEKQGKIIYN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Ubiquitination | -MSFFNFKAFGRNSK -CCCCCCCCCCCCCC | 43.86 | 24961812 | |
| 31 | Phosphorylation | AQPPAMNTIYSSPHS CCCCCHHCCCCCCCC | 14.28 | 20377248 | |
| 33 | Phosphorylation | PPAMNTIYSSPHSSN CCCHHCCCCCCCCCC | 10.89 | 22369663 | |
| 34 | Phosphorylation | PAMNTIYSSPHSSNS CCHHCCCCCCCCCCC | 33.28 | 22369663 | |
| 35 | Phosphorylation | AMNTIYSSPHSSNSR CHHCCCCCCCCCCCC | 15.06 | 22369663 | |
| 38 | Phosphorylation | TIYSSPHSSNSRLSL CCCCCCCCCCCCCCC | 34.30 | 22369663 | |
| 39 | Phosphorylation | IYSSPHSSNSRLSLR CCCCCCCCCCCCCCC | 35.47 | 22369663 | |
| 41 | Phosphorylation | SSPHSSNSRLSLRNK CCCCCCCCCCCCCCC | 36.22 | 22369663 | |
| 44 | Phosphorylation | HSSNSRLSLRNKHHS CCCCCCCCCCCCCCC | 24.95 | 22369663 | |
| 56 | Phosphorylation | HHSPKRHSQTSFPAQ CCCCCCCCCCCCCCC | 38.90 | 22369663 | |
| 58 | Phosphorylation | SPKRHSQTSFPAQKS CCCCCCCCCCCCCCC | 35.04 | 22369663 | |
| 59 | Phosphorylation | PKRHSQTSFPAQKST CCCCCCCCCCCCCCC | 22.92 | 22369663 | |
| 65 | Phosphorylation | TSFPAQKSTPQSQQL CCCCCCCCCCCHHCC | 32.99 | 27017623 | |
| 66 | Phosphorylation | SFPAQKSTPQSQQLT CCCCCCCCCCHHCCC | 32.17 | 23749301 | |
| 69 | Phosphorylation | AQKSTPQSQQLTSTT CCCCCCCHHCCCCCC | 22.54 | 27017623 | |
| 73 | Phosphorylation | TPQSQQLTSTTPQSQ CCCHHCCCCCCCHHH | 21.49 | 23607784 | |
| 74 | Phosphorylation | PQSQQLTSTTPQSQQ CCHHCCCCCCCHHHH | 38.59 | 21440633 | |
| 75 | Phosphorylation | QSQQLTSTTPQSQQQ CHHCCCCCCCHHHHH | 36.94 | 23607784 | |
| 76 | Phosphorylation | SQQLTSTTPQSQQQE HHCCCCCCCHHHHHH | 21.06 | 23749301 | |
| 79 | Phosphorylation | LTSTTPQSQQQEASE CCCCCCHHHHHHHHH | 31.03 | 21440633 | |
| 85 | Phosphorylation | QSQQQEASERSESQQ HHHHHHHHHHCHHHH | 32.56 | 23607784 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MOB2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MOB2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MOB2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
