| UniProt ID | MGMT_YEAST | |
|---|---|---|
| UniProt AC | P26188 | |
| Protein Name | Methylated-DNA--protein-cysteine methyltransferase | |
| Gene Name | MGT1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 188 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Repairs the methylated nucleobase in DNA by stoichiometrically transferring the methyl group to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated. Prefers double-stranded DNA over single-stranded DNA as substrate.. | |
| Protein Sequence | MKELLYYTFIETEVTGAFLVFREKTQNLVFASLGNDKLFLLGKVEGFLKKHEKQDTMYDLQELKEAETYKKSIENYTICLENKMPLPSGAIPFEFLFGTDFQRKVWNELLNVEHGHVVTYGDIAKRIGKPTAARSVGRACGSNNLALLVPCHRIVGSNRKLTGYKWSCKLKEQLLNNEKENSLSLSRL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 186 | Phosphorylation | KENSLSLSRL----- CCCCCCCCCC----- | 28.32 | 27214570 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MGMT_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MGMT_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MGMT_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
