| UniProt ID | GPG1_YEAST | |
|---|---|---|
| UniProt AC | P53130 | |
| Protein Name | Heterotrimeric G protein gamma subunit GPG1 | |
| Gene Name | GPG1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 126 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Gamma subunit of a guanine nucleotide-binding protein (G protein). G proteins are involved as modulators or transducers in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Involved in the determination of the cAMP level according to nutritional conditions, most probably as a regulator of cAMP phosphodiesterase. Required for the control of pseudohyphal and haploid invasive growth.. | |
| Protein Sequence | MFYLSDIEEEASAGAEPTYNFWEVLLFSNTQENLVTVVGELHTLTDRVVHYKIEPESREVTATTLPSLLALLLEKRNQARRLYRDVLSMKMSELDWDIDDLFTQLQEELTRTDDTLSMYPRRRFYH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GPG1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GPG1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GPG1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GPB2_YEAST | GPB2 | physical | 12150916 | |
| GUP1_YEAST | GUP1 | genetic | 20526336 | |
| RNQ1_YEAST | RNQ1 | genetic | 22529103 | |
| SAC3_YEAST | SAC3 | genetic | 27708008 | |
| XRS2_YEAST | XRS2 | genetic | 27708008 | |
| RV167_YEAST | RVS167 | genetic | 27708008 | |
| STP1_YEAST | STP1 | genetic | 27708008 | |
| CAJ1_YEAST | CAJ1 | genetic | 27708008 | |
| SWP82_YEAST | SWP82 | genetic | 27708008 | |
| AIM18_YEAST | AIM18 | genetic | 27708008 | |
| SDHX_YEAST | YJL045W | genetic | 27708008 | |
| JJJ2_YEAST | JJJ2 | genetic | 27708008 | |
| HAL5_YEAST | HAL5 | genetic | 27708008 | |
| ELF1_YEAST | ELF1 | genetic | 27708008 | |
| PSR1_YEAST | PSR1 | genetic | 27708008 | |
| SRN2_YEAST | SRN2 | genetic | 27708008 | |
| COA4_YEAST | COA4 | genetic | 27708008 | |
| CHS5_YEAST | CHS5 | genetic | 27708008 | |
| COX7_YEAST | COX7 | genetic | 27708008 | |
| COG6_YEAST | COG6 | genetic | 27708008 | |
| SWS2_YEAST | SWS2 | genetic | 27708008 | |
| BRE5_YEAST | BRE5 | genetic | 27708008 | |
| MDM12_YEAST | MDM12 | genetic | 27708008 | |
| TAT2_YEAST | TAT2 | genetic | 27708008 | |
| YO114_YEAST | YOL114C | genetic | 27708008 | |
| SERC_YEAST | SER1 | genetic | 27708008 | |
| MNE1_YEAST | MNE1 | genetic | 27708008 | |
| TBP6_YEAST | YTA6 | genetic | 27708008 | |
| BECN1_YEAST | VPS30 | genetic | 27708008 | |
| RTC6_YEAST | RTC6 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
