UniProt ID | YO114_YEAST | |
---|---|---|
UniProt AC | Q12322 | |
Protein Name | Putative uncharacterized protein YOL114C | |
Gene Name | YOL114C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 202 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MTTLMGKFKLTGRSPLFVLQPMLHCKKQQFVEEAVRLISNKKIGKKSDFVQARNWVGALNVTGLPLNQFILRYDRASGPGGQNVNKVNSKCTLTLSGLSNCAWIPQEVRNILSSGRFRYYAKGSDSIVIQSDETRSRETNKLKCFEKLVQEIRQTCQFPNDTTAETSKKWNKIKEKANKERLLDKKVHSDKKKNRSKIKFNY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YO114_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YO114_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YO114_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RL22A_YEAST | RPL22A | genetic | 27708008 | |
IMG2_YEAST | IMG2 | genetic | 27708008 | |
GPR1_YEAST | GPR1 | genetic | 27708008 | |
PEX19_YEAST | PEX19 | genetic | 27708008 | |
LSB3_YEAST | LSB3 | genetic | 27708008 | |
PALF_YEAST | RIM8 | genetic | 27708008 | |
MST27_YEAST | MST27 | genetic | 27708008 | |
COX23_YEAST | COX23 | genetic | 27708008 | |
RS21B_YEAST | RPS21B | genetic | 27708008 | |
YJQ3_YEAST | YJL163C | genetic | 27708008 | |
RM49_YEAST | MRP49 | genetic | 27708008 | |
COA4_YEAST | COA4 | genetic | 27708008 | |
EAF7_YEAST | EAF7 | genetic | 27708008 | |
YP089_YEAST | YPR089W | genetic | 27708008 | |
RL36A_YEAST | RPL36A | genetic | 29158977 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...