| UniProt ID | COX23_YEAST | |
|---|---|---|
| UniProt AC | P38824 | |
| Protein Name | Cytochrome c oxidase-assembly factor COX23, mitochondrial | |
| Gene Name | COX23 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 151 | |
| Subcellular Localization | Cytoplasm . Mitochondrion intermembrane space . | |
| Protein Description | Required for the assembly of cytochrome c oxidase.. | |
| Protein Sequence | MEKPSPTRRQTSSLSTISNGMTMTNDNRDTTNTNSGSTSSNNSQPSSSSTPPAASGPVTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 70 | Phosphorylation | KVNYVPKSDDPSSFQ EEEECCCCCCCCCCC | 40.97 | 30377154 | |
| 74 | Phosphorylation | VPKSDDPSSFQYYPD CCCCCCCCCCCCCCC | 51.26 | 30377154 | |
| 98 | Phosphorylation | KFALKADSQYYDPCE HEEEECCCCCCCCCC | 25.58 | 30377154 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COX23_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COX23_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COX23_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
