UniProt ID | COX23_YEAST | |
---|---|---|
UniProt AC | P38824 | |
Protein Name | Cytochrome c oxidase-assembly factor COX23, mitochondrial | |
Gene Name | COX23 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 151 | |
Subcellular Localization | Cytoplasm . Mitochondrion intermembrane space . | |
Protein Description | Required for the assembly of cytochrome c oxidase.. | |
Protein Sequence | MEKPSPTRRQTSSLSTISNGMTMTNDNRDTTNTNSGSTSSNNSQPSSSSTPPAASGPVTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
70 | Phosphorylation | KVNYVPKSDDPSSFQ EEEECCCCCCCCCCC | 40.97 | 30377154 | |
74 | Phosphorylation | VPKSDDPSSFQYYPD CCCCCCCCCCCCCCC | 51.26 | 30377154 | |
98 | Phosphorylation | KFALKADSQYYDPCE HEEEECCCCCCCCCC | 25.58 | 30377154 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COX23_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COX23_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COX23_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...