| UniProt ID | RCF1_YEAST | |
|---|---|---|
| UniProt AC | Q03713 | |
| Protein Name | Respiratory supercomplex factor 1, mitochondrial | |
| Gene Name | RCF1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 159 | |
| Subcellular Localization |
Mitochondrion membrane Multi-pass membrane protein . |
|
| Protein Description | Cytochrome c oxidase subunit required for growth under hypoxic conditions. Involved in the assembly of the Complex III-Complex IV supercomplex, as well as in the recruitment of COX13 and RCF2 into cytochrome c oxidase. May also be required for late-stage assembly of the COX12 and COX13 subunits and for cytochrome c oxidase activity.. | |
| Protein Sequence | MSRMPSSFDVTERDLDDMTFGERIIYHCKKQPLVPIGCLLTTGAVILAAQNVRLGNKWKAQYYFRWRVGLQAATLVALVAGSFIYGTSGKELKAKEEQLKEKAKMREKLWIQELERREEETEARRKRAELARMKTLENEEEIKNLEKELSDLENKLGKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSRMPSSFD ------CCCCCCCCC | 30377154 | ||
| 6 | Phosphorylation | --MSRMPSSFDVTER --CCCCCCCCCCCCC | 30377154 | ||
| 7 | Phosphorylation | -MSRMPSSFDVTERD -CCCCCCCCCCCCCC | 30377154 | ||
| 11 | Phosphorylation | MPSSFDVTERDLDDM CCCCCCCCCCCCCCC | 30377154 | ||
| 19 | Phosphorylation | ERDLDDMTFGERIIY CCCCCCCCHHHHHHH | 30377154 | ||
| 150 | Phosphorylation | KNLEKELSDLENKLG HHHHHHHHHHHHHHC | 30377154 | ||
| 155 | Acetylation | ELSDLENKLGKK--- HHHHHHHHHCCC--- | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RCF1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RCF1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RCF1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
