| UniProt ID | COA6_YEAST | |
|---|---|---|
| UniProt AC | Q3E846 | |
| Protein Name | Cytochrome c oxidase assembly factor 6 {ECO:0000303|PubMed:22984289} | |
| Gene Name | COA6 {ECO:0000303|PubMed:22984289} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 104 | |
| Subcellular Localization | Cytoplasm . Nucleus . Mitochondrion intermembrane space . Imported into the mitochondria via the mitochondrial MIA40-ERV1 machinery. | |
| Protein Description | Involved in the maturation of the mitochondrial respiratory chain complex IV subunit MT-CO2/COX2. Thereby, may regulate early steps of complex IV assembly. Mitochondrial respiratory chain complex IV or cytochrome c oxidase is the component of the respiratory chain that catalyzes the transfer of electrons from intermembrane space cytochrome c to molecular oxygen in the matrix and as a consequence contributes to the proton gradient involved in mitochondrial ATP synthesis. May also be required for efficient formation of respiratory supercomplexes comprised of complexes III and IV.. | |
| Protein Sequence | MGLFSFDGGKKESQPPNTRSQRKLCWESRDAFFQCLDKADILDAMDPKNSKSIKSHCKVENEKFEENCAHSWIKYFKEKRVIDFKREQTIKRIEQEAKQRERNQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Phosphorylation | ---MGLFSFDGGKKE ---CCCCCCCCCCCC | 30377154 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COA6_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COA6_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COA6_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SCO2_YEAST | SCO2 | genetic | 26669719 | |
| COX12_YEAST | COX12 | genetic | 26669719 | |
| COX2_YEAST | COX2 | physical | 26669719 | |
| SCO1_YEAST | SCO1 | genetic | 26669719 | |
| COX20_YEAST | COX20 | genetic | 26669719 | |
| PIC2_YEAST | PIC2 | genetic | 26669719 | |
| BUD31_YEAST | BUD31 | genetic | 27708008 | |
| RS8A_YEAST | RPS8A | genetic | 27708008 | |
| RS8B_YEAST | RPS8A | genetic | 27708008 | |
| MGR1_YEAST | MGR1 | genetic | 27708008 | |
| RV161_YEAST | RVS161 | genetic | 27708008 | |
| GPR1_YEAST | GPR1 | genetic | 27708008 | |
| RV167_YEAST | RVS167 | genetic | 27708008 | |
| SPG1_YEAST | SPG1 | genetic | 27708008 | |
| TBP7_YEAST | YTA7 | genetic | 27708008 | |
| SNF6_YEAST | SNF6 | genetic | 27708008 | |
| MED20_YEAST | SRB2 | genetic | 27708008 | |
| ICE2_YEAST | ICE2 | genetic | 27708008 | |
| LTHAD_YEAST | SRY1 | genetic | 27708008 | |
| VPS27_YEAST | VPS27 | genetic | 27708008 | |
| IRA2_YEAST | IRA2 | genetic | 27708008 | |
| ALE1_YEAST | ALE1 | genetic | 27708008 | |
| MPC54_YEAST | MPC54 | genetic | 27708008 | |
| HSP82_YEAST | HSP82 | genetic | 27708008 | |
| SKI3_YEAST | SKI3 | genetic | 27708008 | |
| COX2_YEAST | COX2 | physical | 25959673 | |
| SCO1_YEAST | SCO1 | physical | 25959673 | |
| SCO2_YEAST | SCO2 | physical | 25959673 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
