| UniProt ID | MGR1_YEAST | |
|---|---|---|
| UniProt AC | P25573 | |
| Protein Name | Mitochondrial inner membrane i-AAA protease supercomplex subunit MGR1 | |
| Gene Name | MGR1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 417 | |
| Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
| Protein Description | Component of the mitochondrial inner membrane i-AAA protease supercomplex required for mitochondrial inner membrane protein turnover. Together with MGR3, functions in an adapter complex that targets substrates to the i-AAA protease for degradation. Required for growth of cells lacking the mitochondrial genome.. | |
| Protein Sequence | MAVFTPPSGNSNSTDHTHTQDDHDKDDNDIKKFYIRPSLGLKLWGPLVPAPDNLPGLYTLITIQSAVGFFALWRLRRLYKLPPPRRIATGTHSDLSFGELPSEMIVNGKTKIKKDIADFPTLNRFSTTHGDIVLAPPPIIPRQSRFVSVRKLLWGLFGSLLLSQSLLELTRLNFLKYDPWCDEMKSVRDKKFFNNIVKYYHEGIDPTKIKVKDAMNGTPLSTNIPEVKQSVALARAQVEAQNPIIKWFGPLEYKPMSFNEYLNRMEFHLDMFEFFQNKRNIRENSIELINSISHNPQSSSTGLEGLSESKKLHLQNVEKRLHFLASSGDSISAPVKKRSSTTLSRGVILPHDTKGPQDIDLDTIRSLYDPWMTLALETSLSIKFIPTTMPSHTKTPTSTDQPLPGPTPKALTNEKTH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 126 | Phosphorylation | FPTLNRFSTTHGDIV CCCCCCCCCCCCCEE | 29.20 | 30377154 | |
| 208 | Acetylation | HEGIDPTKIKVKDAM HCCCCCCCEEHHHCC | 46.01 | 24489116 | |
| 341 | Phosphorylation | PVKKRSSTTLSRGVI CCCCCCCCCCCCCEE | 32.76 | 28889911 | |
| 342 | Phosphorylation | VKKRSSTTLSRGVIL CCCCCCCCCCCCEEC | 25.37 | 28889911 | |
| 368 | Phosphorylation | LDTIRSLYDPWMTLA HHHHHHHHCHHHHHH | 22.62 | 27017623 | |
| 373 | Phosphorylation | SLYDPWMTLALETSL HHHCHHHHHHHHHEE | 12.66 | 27017623 | |
| 381 | Phosphorylation | LALETSLSIKFIPTT HHHHHEEEEEECCCC | 24.41 | 27017623 | |
| 391 | Phosphorylation | FIPTTMPSHTKTPTS ECCCCCCCCCCCCCC | 32.73 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MGR1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MGR1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MGR1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
