| UniProt ID | TIM13_YEAST | |
|---|---|---|
| UniProt AC | P53299 | |
| Protein Name | Mitochondrial import inner membrane translocase subunit TIM13 | |
| Gene Name | TIM13 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 105 | |
| Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Intermembrane side . Mitochondrion intermembrane space . |
|
| Protein Description | Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins under precise conditions while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins. Strictly required for import of TIM23 in some conditions, when a low membrane potential exists in the mitochondria.. | |
| Protein Sequence | MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELVNKISENCFEKCLTSPYATRNDACIDQCLAKYMRSWNVISKAYISRIQNASASGEI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MGLSSIFGGGA ----CCCCHHCCCCC | 18.69 | 23749301 | |
| 5 | Phosphorylation | ---MGLSSIFGGGAP ---CCCCHHCCCCCC | 27.29 | 27017623 | |
| 13 | Phosphorylation | IFGGGAPSQQKEAAT HCCCCCCHHHHHHHH | 44.71 | 28132839 | |
| 31 | Acetylation | TTPNPIAKELKNQIA CCCCHHHHHHHHHHH | 65.38 | 24489116 | |
| 81 | Phosphorylation | IDQCLAKYMRSWNVI HHHHHHHHHHHHHHH | 7.67 | 19779198 | |
| 100 | Phosphorylation | ISRIQNASASGEI-- HHHHHHCCCCCCC-- | 30.43 | 19779198 | |
| 102 | Phosphorylation | RIQNASASGEI---- HHHHCCCCCCC---- | 34.17 | 19779198 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIM13_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIM13_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIM13_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
