DOT5_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DOT5_YEAST
• UniProt AC: P40553
• Protein Name: Peroxiredoxin DOT5 {ECO:0000305}
• Gene Name: DOT5 {ECO:0000303|PubMed:9755194}
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 215
• Subcellular Localization: Nucleus . Chromosome, telomere .
• Protein Description: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Has a role in telomere silencing, which is the repression of chromatin structure which leads to a stop in the transcription of nearby genes. Also has a role in the regulation of telomere length. Acts as an alkyl-hydroperoxide reductase in the nucleus during post-diauxic growth. Preferentially reduces alkyl-hydroperoxides rather than hydrogen peroxide. Acts as an antioxidant necessary for stationary phase survival..
• Protein Sequence: MGEALRRSTRIAISKRMLEEEESKLAPISTPEVPKKKIKTGPKHNANQAVVQEANRSSDVNELEIGDPIPDLSLLNEDNDSISLKKITENNRVVVFFVYPRASTPGCTRQACGFRDNYQELKKYAAVFGLSADSVTSQKKFQSKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFIFVDGKLKFKRVKISPEVSVNDAKKEVLEVAEKFKEE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
23	Phosphorylation	RMLEEEESKLAPIST HHHHHHHHHCCCCCC	35.93	30377154
24	Acetylation	MLEEEESKLAPISTP HHHHHHHHCCCCCCC	52.53	24489116
29	Phosphorylation	ESKLAPISTPEVPKK HHHCCCCCCCCCCHH	36.53	28152593
30	Phosphorylation	SKLAPISTPEVPKKK HHCCCCCCCCCCHHH	24.96	28152593
104	Phosphorylation	FVYPRASTPGCTRQA EEECCCCCCCCCHHC	23.79	28889911
211	Acetylation	EVLEVAEKFKEE--- HHHHHHHHHHCC---	52.58	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DOT5_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DOT5_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DOT5_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NGG1_YEAST	NGG1	genetic	17314980
NOT2_YEAST	CDC36	genetic	17314980
SUS1_YEAST	SUS1	genetic	17314980
RGP1_YEAST	RGP1	genetic	17314980
LSM6_YEAST	LSM6	genetic	17314980
RTG3_YEAST	RTG3	genetic	17314980
STU1_YEAST	STU1	genetic	27708008
GPI10_YEAST	GPI10	genetic	27708008
SMD1_YEAST	SMD1	genetic	27708008
RFC2_YEAST	RFC2	genetic	27708008
UTP13_YEAST	UTP13	genetic	27708008
SEC22_YEAST	SEC22	genetic	27708008
AFG2_YEAST	AFG2	genetic	27708008
NAT10_YEAST	KRE33	genetic	27708008
ASA1_YEAST	ASA1	genetic	27708008
BUR1_YEAST	SGV1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"A multidimensional chromatography technology for in-depthphosphoproteome analysis.";
Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.;
Mol. Cell. Proteomics 7:1389-1396(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-30, AND MASSSPECTROMETRY.
PubMed: 18407956