dbPTM

SAW1_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SAW1_YEAST
UniProt AC	P39735
Protein Name	Single-strand annealing weakened protein 1
Gene Name	SAW1
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	261
Subcellular Localization	Nucleus .
Protein Description	Catalyzes 3'-non-homologous tail removal of RAD1/RAD10-dependent single-strand annealing recombination intermediates. Plays a key role in targeting RAD1/RAD10 complex to 3'-flap cleavage substrate in recombination. Also contributes to the integrity of ribosomal DNA arrays..
Protein Sequence	MAPSIATVKIARDMVLPLRIFVNRKQILQTNDKTSNKSNATIFEAPLLSNNSIICLKSPNTRIYLSQQDKKNLCDEIKEDLLLIVYELASPEIISSVLSKIRVGHSTDFQINVLPKLFAGADTDNAVTSHIQSVTRLAKFKYKLHYKHKWELDIFINSIKKIANLRHYLMFQTLTLNGFSLNAGPKTLLARKIEKQPQVPNLLIENGDADALDTPVEEDIKPVIEFMYKPVINLGEIIDVHVLHRPRRHKVRTQSKQPQEE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SAW1_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SAW1_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SAW1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SAW1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ADH1_YEAST	ADH1	physical	11805826
GIN4_YEAST	GIN4	physical	11805826
HMO1_YEAST	HMO1	physical	11805826
KCC4_YEAST	KCC4	physical	11805826
PDC1_YEAST	PDC1	physical	11805826
G6PI_YEAST	PGI1	physical	11805826
RAD1_YEAST	RAD1	physical	11805826
RAD10_YEAST	RAD10	physical	11805826
YRA1_YEAST	YRA1	physical	11805826
RV161_YEAST	RVS161	physical	16554755
RIM1_YEAST	RIM1	physical	16554755
FBRL_YEAST	NOP1	physical	16554755
YRA1_YEAST	YRA1	physical	16554755
RV167_YEAST	RVS167	physical	16554755
MLC1_YEAST	MLC1	physical	16554755
PRK1_YEAST	PRK1	physical	16554755
SLM1_YEAST	SLM1	physical	16554755
SYDC_YEAST	DPS1	physical	16554755
CORO_YEAST	CRN1	physical	16554755
RAD10_YEAST	RAD10	physical	16554755
INP52_YEAST	INP52	physical	16554755
RRS1_YEAST	RRS1	physical	16554755
LSP1_YEAST	LSP1	physical	16554755
RAD1_YEAST	RAD1	physical	16554755
NOP53_YEAST	NOP53	physical	16554755
BSP1_YEAST	BSP1	physical	16554755
TPA1_YEAST	TPA1	physical	16554755
DHR1_YEAST	ECM16	physical	16554755
RAD1_YEAST	RAD1	physical	18471978
MSH2_YEAST	MSH2	physical	18471978
MSH3_YEAST	MSH3	physical	18471978
RAD52_YEAST	RAD52	physical	18471978
RAD51_YEAST	RAD51	physical	18471978
RAD1_YEAST	RAD1	physical	18719252
RAD1_YEAST	RAD1	physical	23299942
MSH2_YEAST	MSH2	physical	23299942
RAD52_YEAST	RAD52	physical	23299942
RAD10_YEAST	RAD10	physical	24565838
RAD59_YEAST	RAD59	genetic	25263559
APN1_YEAST	APN1	genetic	25263559
APN2_YEAST	APN2	genetic	25263559
TYDP1_YEAST	TDP1	genetic	25263559
SLX4_YEAST	SLX4	physical	25263559
RAD1_YEAST	RAD1	physical	25263559
CSG2_YEAST	CSG2	genetic	27708008
ARI1_YEAST	ARI1	genetic	27708008
YJ24_YEAST	KCH1	genetic	27708008
DAN1_YEAST	DAN1	genetic	27708008
YKE44_YEAST	YKL044W	genetic	27708008
RAD1_YEAST	RAD1	physical	29660012
RAD10_YEAST	RAD10	physical	29660012
MSH3_YEAST	MSH3	physical	29660012
MSH2_YEAST	MSH2	physical	29660012

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SAW1_YEAST

Related Literatures of Post-Translational Modification