| UniProt ID | HMO1_YEAST | |
|---|---|---|
| UniProt AC | Q03973 | |
| Protein Name | High mobility group protein 1 | |
| Gene Name | HMO1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 246 | |
| Subcellular Localization | Nucleus, nucleolus . Colocalizes with FOB1. | |
| Protein Description | DNA-binding protein that is probably part of the rDNA transcription apparatus. Acts synergetically with the RPA49 subunit of RNA polymerase I during rDNA transcription. May participate in mutagenesis control.. | |
| Protein Sequence | MTTDPSVKLKSAKDSLVSSLFELSKAANQTASSIVDFYNAIGDDEEEKIEAFTTLTESLQTLTSGVNHLHGISSELVNPIDDDKDAIIAAPVKAVRRKIERDPNAPKKPLTVFFAYSAYVRQELREDRQKAGLPPLSSTEITQEISKKWKELSDNEKEKWKQAYNVELENYQREKSKYLEAKKNGTLPPASLENGPTHAPVPIPFSLQHAAEPPVEKRPHDDDGSSEKKKKKKKKDKKKDKSNSSI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 13 | Acetylation | SVKLKSAKDSLVSSL CHHHHHHHHHHHHHH | 55.74 | 24489116 | |
| 137 | Phosphorylation | KAGLPPLSSTEITQE HCCCCCCCHHHHHHH | 40.77 | 27214570 | |
| 139 | Phosphorylation | GLPPLSSTEITQEIS CCCCCCHHHHHHHHH | 28.20 | 27214570 | |
| 153 | Phosphorylation | SKKWKELSDNEKEKW HHHHHHCCHHHHHHH | 39.21 | 25704821 | |
| 225 | Phosphorylation | RPHDDDGSSEKKKKK CCCCCCCCHHHHHHH | 42.17 | 27214570 | |
| 226 | Phosphorylation | PHDDDGSSEKKKKKK CCCCCCCHHHHHHHH | 59.99 | 27717283 | |
| 228 | Acetylation | DDDGSSEKKKKKKKK CCCCCHHHHHHHHHH | 72.36 | 25381059 | |
| 242 | Phosphorylation | KDKKKDKSNSSI--- HHHHCCCCCCCC--- | 52.67 | 28889911 | |
| 245 | Phosphorylation | KKDKSNSSI------ HCCCCCCCC------ | 36.25 | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HMO1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HMO1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HMO1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
