| UniProt ID | RS19A_YEAST | |
|---|---|---|
| UniProt AC | P07280 | |
| Protein Name | 40S ribosomal protein S19-A {ECO:0000303|PubMed:9559554} | |
| Gene Name | RPS19A {ECO:0000303|PubMed:9559554} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 144 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel. [PubMed: 22096102 eS19 is required for proper maturation of the small (40S) ribosomal subunit. Binds to 40S pre-ribosomal particles, probably required after association of NOC4 but before association of ENP1, TSR1 and RIO2 with 20/21S pre-rRNA] | |
| Protein Sequence | MPGVSVRDVAAQDFINAYASFLQRQGKLEVPGYVDIVKTSSGNEMPPQDAEGWFYKRAASVARHIYMRKQVGVGKLNKLYGGAKSRGVRPYKHIDASGSINRKVLQALEKIGIVEISPKGGRRISENGQRDLDRIAAQTLEEDE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 18 | Phosphorylation | AQDFINAYASFLQRQ HHHHHHHHHHHHHHC | 9.78 | 21126336 | |
| 20 | Phosphorylation | DFINAYASFLQRQGK HHHHHHHHHHHHCCC | 17.51 | 28889911 | |
| 27 | Acetylation | SFLQRQGKLEVPGYV HHHHHCCCCCCCCEE | 32.89 | 24489116 | |
| 27 | Ubiquitination | SFLQRQGKLEVPGYV HHHHHCCCCCCCCEE | 32.89 | 23749301 | |
| 27 | Succinylation | SFLQRQGKLEVPGYV HHHHHCCCCCCCCEE | 32.89 | 23954790 | |
| 39 | Phosphorylation | GYVDIVKTSSGNEMP CEEEEEECCCCCCCC | 19.75 | 21440633 | |
| 41 | Phosphorylation | VDIVKTSSGNEMPPQ EEEEECCCCCCCCCC | 51.36 | 23749301 | |
| 56 | Ubiquitination | DAEGWFYKRAASVAR CCCCHHHHHHHHHHH | 26.53 | 23749301 | |
| 56 | Acetylation | DAEGWFYKRAASVAR CCCCHHHHHHHHHHH | 26.53 | 24489116 | |
| 56 | Succinylation | DAEGWFYKRAASVAR CCCCHHHHHHHHHHH | 26.53 | 23954790 | |
| 60 | Phosphorylation | WFYKRAASVARHIYM HHHHHHHHHHHHHHH | 18.48 | 17287358 | |
| 69 | 2-Hydroxyisobutyrylation | ARHIYMRKQVGVGKL HHHHHHHHHCCCCHH | 32.57 | - | |
| 75 | Ubiquitination | RKQVGVGKLNKLYGG HHHCCCCHHHHHHCC | 46.62 | 22817900 | |
| 75 | Acetylation | RKQVGVGKLNKLYGG HHHCCCCHHHHHHCC | 46.62 | 24489116 | |
| 78 | Ubiquitination | VGVGKLNKLYGGAKS CCCCHHHHHHCCCCC | 54.22 | 23749301 | |
| 78 | 2-Hydroxyisobutyrylation | VGVGKLNKLYGGAKS CCCCHHHHHHCCCCC | 54.22 | - | |
| 78 | Acetylation | VGVGKLNKLYGGAKS CCCCHHHHHHCCCCC | 54.22 | 24489116 | |
| 78 | Succinylation | VGVGKLNKLYGGAKS CCCCHHHHHHCCCCC | 54.22 | 23954790 | |
| 84 | Succinylation | NKLYGGAKSRGVRPY HHHHCCCCCCCCCCC | 43.91 | 23954790 | |
| 84 | Ubiquitination | NKLYGGAKSRGVRPY HHHHCCCCCCCCCCC | 43.91 | 23749301 | |
| 84 | Acetylation | NKLYGGAKSRGVRPY HHHHCCCCCCCCCCC | 43.91 | 24489116 | |
| 85 | Phosphorylation | KLYGGAKSRGVRPYK HHHCCCCCCCCCCCC | 33.46 | 19823750 | |
| 91 | Phosphorylation | KSRGVRPYKHIDASG CCCCCCCCCCCCCCC | 12.48 | 19823750 | |
| 92 | Ubiquitination | SRGVRPYKHIDASGS CCCCCCCCCCCCCCC | 36.45 | 22817900 | |
| 92 | Acetylation | SRGVRPYKHIDASGS CCCCCCCCCCCCCCC | 36.45 | 24489116 | |
| 97 | Phosphorylation | PYKHIDASGSINRKV CCCCCCCCCCCCHHH | 29.35 | 21082442 | |
| 99 | Phosphorylation | KHIDASGSINRKVLQ CCCCCCCCCCHHHHH | 17.75 | 28889911 | |
| 103 | Ubiquitination | ASGSINRKVLQALEK CCCCCCHHHHHHHHH | 42.69 | 23749301 | |
| 110 | Acetylation | KVLQALEKIGIVEIS HHHHHHHHHCCEEEC | 47.27 | 24489116 | |
| 110 | Ubiquitination | KVLQALEKIGIVEIS HHHHHHHHHCCEEEC | 47.27 | 23749301 | |
| 117 | Phosphorylation | KIGIVEISPKGGRRI HHCCEEECCCCCCCC | 13.67 | 22369663 | |
| 119 | Acetylation | GIVEISPKGGRRISE CCEEECCCCCCCCCC | 68.18 | 24489116 | |
| 119 | Ubiquitination | GIVEISPKGGRRISE CCEEECCCCCCCCCC | 68.18 | 23749301 | |
| 125 | Phosphorylation | PKGGRRISENGQRDL CCCCCCCCCCCCHHH | 24.17 | 30377154 | |
| 139 | Phosphorylation | LDRIAAQTLEEDE-- HHHHHHHHHHCCC-- | 31.26 | 28152593 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS19A_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS19A_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS19A_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
