| UniProt ID | YKG3_YEAST | |
|---|---|---|
| UniProt AC | P35725 | |
| Protein Name | Uncharacterized protein YKL063C | |
| Gene Name | YKL063C | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 167 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MQGDIRRKKDLLPRYKTGSKYNSRRRGGYLTTPMKKIIVYIILLCGVYFVIKVAYSDLNKETEIKLESHSSDVSASASDHTNIAAGGAADATNNKQPQQAKVPKEKFNNEVAKQQEVKNLENDLKPQIDSEKQKQINKDKKEQKQQLQKEKQDLAKENLANNEILDN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 106 | Ubiquitination | QAKVPKEKFNNEVAK HCCCCHHHHCHHHHH | 60.56 | 19722269 | |
| 125 | Acetylation | KNLENDLKPQIDSEK HHHHHCCHHCCCHHH | 37.43 | 24489116 | |
| 132 | Acetylation | KPQIDSEKQKQINKD HHCCCHHHHHHHCHH | 67.74 | 24489116 | |
| 151 | Acetylation | KQQLQKEKQDLAKEN HHHHHHHHHHHHHHH | 57.03 | 24489116 | |
| 156 | Acetylation | KEKQDLAKENLANNE HHHHHHHHHHHHHCC | 55.20 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YKG3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YKG3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YKG3_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| BFR1_YEAST | BFR1 | genetic | 16269340 | |
| RIC1_YEAST | RIC1 | genetic | 16269340 | |
| RGP1_YEAST | RGP1 | genetic | 16269340 | |
| SPT23_YEAST | SPT23 | genetic | 16269340 | |
| GOSR1_YEAST | GOS1 | genetic | 16269340 | |
| TSC3_YEAST | TSC3 | genetic | 16269340 | |
| MGLL_YEAST | YJU3 | genetic | 16269340 | |
| PLMT_YEAST | OPI3 | genetic | 16269340 | |
| SEC62_YEAST | SEC62 | physical | 18719252 | |
| INO2_YEAST | INO2 | genetic | 27708008 | |
| PHB2_YEAST | PHB2 | genetic | 27708008 | |
| GOSR1_YEAST | GOS1 | genetic | 27708008 | |
| RAD14_YEAST | RAD14 | genetic | 27708008 | |
| PET8_YEAST | PET8 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...