UniProt ID | YKG3_YEAST | |
---|---|---|
UniProt AC | P35725 | |
Protein Name | Uncharacterized protein YKL063C | |
Gene Name | YKL063C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 167 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MQGDIRRKKDLLPRYKTGSKYNSRRRGGYLTTPMKKIIVYIILLCGVYFVIKVAYSDLNKETEIKLESHSSDVSASASDHTNIAAGGAADATNNKQPQQAKVPKEKFNNEVAKQQEVKNLENDLKPQIDSEKQKQINKDKKEQKQQLQKEKQDLAKENLANNEILDN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
106 | Ubiquitination | QAKVPKEKFNNEVAK HCCCCHHHHCHHHHH | 60.56 | 19722269 | |
125 | Acetylation | KNLENDLKPQIDSEK HHHHHCCHHCCCHHH | 37.43 | 24489116 | |
132 | Acetylation | KPQIDSEKQKQINKD HHCCCHHHHHHHCHH | 67.74 | 24489116 | |
151 | Acetylation | KQQLQKEKQDLAKEN HHHHHHHHHHHHHHH | 57.03 | 24489116 | |
156 | Acetylation | KEKQDLAKENLANNE HHHHHHHHHHHHHCC | 55.20 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YKG3_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YKG3_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YKG3_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BFR1_YEAST | BFR1 | genetic | 16269340 | |
RIC1_YEAST | RIC1 | genetic | 16269340 | |
RGP1_YEAST | RGP1 | genetic | 16269340 | |
SPT23_YEAST | SPT23 | genetic | 16269340 | |
GOSR1_YEAST | GOS1 | genetic | 16269340 | |
TSC3_YEAST | TSC3 | genetic | 16269340 | |
MGLL_YEAST | YJU3 | genetic | 16269340 | |
PLMT_YEAST | OPI3 | genetic | 16269340 | |
SEC62_YEAST | SEC62 | physical | 18719252 | |
INO2_YEAST | INO2 | genetic | 27708008 | |
PHB2_YEAST | PHB2 | genetic | 27708008 | |
GOSR1_YEAST | GOS1 | genetic | 27708008 | |
RAD14_YEAST | RAD14 | genetic | 27708008 | |
PET8_YEAST | PET8 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...