| UniProt ID | PLMT_YEAST | |
|---|---|---|
| UniProt AC | P05375 | |
| Protein Name | Phosphatidyl-N-methylethanolamine N-methyltransferase {ECO:0000255|HAMAP-Rule:MF_03216, ECO:0000305} | |
| Gene Name | OPI3 {ECO:0000303|PubMed:7047296} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 206 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . Mitochondrion membrane Multi-pass membrane protein . |
|
| Protein Description | Catalyzes the second two steps of the methylation pathway of phosphatidylcholine biosynthesis, the SAM-dependent methylation of phosphatidylmonomethylethanolamine (PMME) to phosphatidyldimethylethanolamine (PDME) and of PDME to phosphatidylcholine (PC). Can also catalyze the first methylation reaction of PE to PMME in the absence of PE methyltransferase CHO2.. | |
| Protein Sequence | MKESVQEIIQQLIHSVDLQSSKFQLAIVCTMFNPIFWNIVARMEYHKHSLTKMCGGARKGCYMLAATIFSLGIVRDMVYESALREQPTCSLITGENWTKLGVALFGLGQVLVLSSMYKLGITGTYLGDYFGILMDERVTGFPFNVSNNPMYQGSTLSFLGIALYKGKPAGLVVSAVVYFMYKIALRWEEPFTAMIYANRDKAKKNM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 139 | Phosphorylation | ILMDERVTGFPFNVS EEECCCCCCCCCCCC | 29136822 | ||
| 146 | Phosphorylation | TGFPFNVSNNPMYQG CCCCCCCCCCCCCCC | 29136822 | ||
| 151 | Phosphorylation | NVSNNPMYQGSTLSF CCCCCCCCCCCCEEH | 29136822 | ||
| 154 | Phosphorylation | NNPMYQGSTLSFLGI CCCCCCCCCEEHHHH | 29136822 | ||
| 155 | Phosphorylation | NPMYQGSTLSFLGIA CCCCCCCCEEHHHHH | 29136822 | ||
| 157 | Phosphorylation | MYQGSTLSFLGIALY CCCCCCEEHHHHHHH | 29136822 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PLMT_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PLMT_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PLMT_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...