| UniProt ID | ROT1_YEAST | |
|---|---|---|
| UniProt AC | Q03691 | |
| Protein Name | Protein ROT1 | |
| Gene Name | ROT1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 256 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type I membrane protein . |
|
| Protein Description | Required for normal levels of the cell wall 1,6-beta-glucan. Involved in a protein folding machinery chaperoning proteins acting in various physiological processes including cell wall synthesis and lysis of autophagic bodies. Controls actin cytoskeleton polarization to the mother-bud neck and CLB2 protein stability.. | |
| Protein Sequence | MWSKKFTLKKLILGGYLFAQKVYCEDESNSIYGTWSSKSNQVFTGPGFYDPVDELLIEPSLPGLSYSFTEDGWYEEATYQVSGNPRNPTCPMASLIYQHGTYNISENGTLVLNPIEVDGRQLFSDPCNDDGVSTYSRYNQTETFKEYAVGIDPYHGIYTLQLYQYDGTPMQPLYLAYRPPMMLPTETLNPTSSATSTDDPSSNKKRSLRSLVRRSLENRHKTNAIKRQNTSFLTSNAIWYISAGMLGVGSLLFLAF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 103 | N-linked_Glycosylation | IYQHGTYNISENGTL ECCCCCEEECCCCEE | 31.02 | 17914748 | |
| 107 | N-linked_Glycosylation | GTYNISENGTLVLNP CCEEECCCCEEEECC | 41.79 | 17914748 | |
| 139 | N-linked_Glycosylation | VSTYSRYNQTETFKE CCCCCCCCCCCCHHH | 40.98 | 17914748 | |
| 191 | Phosphorylation | PTETLNPTSSATSTD CCCCCCCCCCCCCCC | 33.95 | 27017623 | |
| 192 | Phosphorylation | TETLNPTSSATSTDD CCCCCCCCCCCCCCC | 21.16 | 27017623 | |
| 202 | Phosphorylation | TSTDDPSSNKKRSLR CCCCCCCCHHHHHHH | 59.04 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ROT1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ROT1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ROT1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
