| UniProt ID | ERG4_YEAST | |
|---|---|---|
| UniProt AC | P25340 | |
| Protein Name | Delta(24(24(1)))-sterol reductase | |
| Gene Name | ERG4 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 473 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein. |
|
| Protein Description | ||
| Protein Sequence | MAKDNSEKLQVQGEEKKSKQPVNFLPQGKWLKPNEIEYEFGGTTGVIGMLIGFPLLMYYMWICAEFYHGKVALPKAGESWMHFIKHLYQLVLENGIPEKYDWTIFLTFWVFQIIFYYTLPGIWTKGQPLSHLKGKQLPYFCNAMWTLYVTTTLVLVLHFTNLFRLYVIIDRFGRIMTCAIISGFAFSIILYLWTLFISHDYHRMTGNHLYDFFMGAPLNPRWGILDLKMFFEVRLPWFTLYFITLGACLKQWETYGYVTPQLGVVMLAHWLYANACAKGEELIVPTWDMAYEKFGFMLIFWNIAGVPYTYCHCTLYLYYHDPSEYHWSTLYNVSLYVVLLCAYYFFDTANAQKNAFRKQMSGDKTGRKTFPFLPYQILKNPKYMVTSNGSYLLIDGWYTLARKIHYTADWTQSLVWALSCGFNSVFPWFFPVFFLVVLIHRAFRDQAKCKRKYGKDWDEYCKHCPYVFIPYVF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Ubiquitination | MAKDNSEKLQVQGEE CCCCCCHHHCCCCCC | 44.00 | 23749301 | |
| 16 | Ubiquitination | LQVQGEEKKSKQPVN HCCCCCCCCCCCCCC | 59.03 | 23749301 | |
| 19 | Ubiquitination | QGEEKKSKQPVNFLP CCCCCCCCCCCCCCC | 68.45 | 23749301 | |
| 133 | Ubiquitination | GQPLSHLKGKQLPYF CCCCHHCCCCCCHHH | 59.65 | 22817900 | |
| 135 | Ubiquitination | PLSHLKGKQLPYFCN CCHHCCCCCCHHHHH | 47.26 | 22817900 | |
| 368 | Ubiquitination | SGDKTGRKTFPFLPY CCCCCCCCCCCCCCH | 56.73 | 23749301 | |
| 379 | Acetylation | FLPYQILKNPKYMVT CCCHHHHCCCCEEEE | 73.21 | 24489116 | |
| 455 | Acetylation | KCKRKYGKDWDEYCK HHHHHHCCCHHHHHH | 53.18 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ERG4_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ERG4_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ERG4_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
