| UniProt ID | ERG28_YEAST | |
|---|---|---|
| UniProt AC | P40030 | |
| Protein Name | Ergosterol biosynthetic protein 28 | |
| Gene Name | ERG28 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 148 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
| Protein Description | Has a role as a scaffold to help anchor ERG25, ERG26 and ERG27 to the endoplasmic reticulum. May also be responsible for facilitating their interaction.. | |
| Protein Sequence | MFSLQDVITTTKTTLAAMPKGYLPKWLLFISIVSVFNSIQTYVSGLELTRKVYERKPTETTHLSARTFGTWTFISCVIRFYGAMYLNEPHIFELVFMSYMVALFHFGSELLIFRTCKLGKGFMGPLVVSTTSLVWMYKQREYYTGVAW | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of ERG28_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ERG28_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ERG28_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ERG28_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ERG6_YEAST | ERG6 | physical | 15522820 | |
| ERG6_YEAST | ERG6 | physical | 15995173 | |
| ERG1_YEAST | ERG1 | physical | 15995173 | |
| CP51_YEAST | ERG11 | physical | 15995173 | |
| MSMO_YEAST | ERG25 | physical | 15995173 | |
| ERG26_YEAST | ERG26 | physical | 15995173 | |
| ERG27_YEAST | ERG27 | physical | 15995173 | |
| ERG28_YEAST | ERG28 | physical | 15995173 | |
| UPC2_YEAST | UPC2 | genetic | 16702413 | |
| ECM22_YEAST | ECM22 | genetic | 16702413 | |
| YND1_YEAST | YND1 | genetic | 16702413 | |
| GDA1_YEAST | GDA1 | genetic | 16702413 | |
| ERG6_YEAST | ERG6 | physical | 16300994 | |
| ERG28_YEAST | ERG28 | physical | 16300994 | |
| ERG27_YEAST | ERG27 | physical | 16300994 | |
| MSMO_YEAST | ERG25 | physical | 16300994 | |
| CP51_YEAST | ERG11 | physical | 16300994 | |
| TAR1_YEAST | TAR1 | genetic | 16702413 | |
| PDR10_YEAST | PDR10 | physical | 23831759 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
