| UniProt ID | TAR1_YEAST | |
|---|---|---|
| UniProt AC | Q8TGM6 | |
| Protein Name | Protein TAR1 | |
| Gene Name | TAR1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 124 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | May be involved in mtDNA stability or mitochondrial gene expression regulation at the post-transcriptional level.. | |
| Protein Sequence | MRDSPTHKEQRAQNTMSDQMPFPFNNFTYFFTLFSKFFSSFHHCTCSLSVSRQYLALDGIYHPLRAAFPNNSTLRRHFTKNRTPRHTGFSPSMTSCSKEHRQGTAPKLPSPNYNSGTEGTRFQI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 90 | Phosphorylation | TPRHTGFSPSMTSCS CCCCCCCCCCHHHCC | 19.87 | 27017623 | |
| 95 | Phosphorylation | GFSPSMTSCSKEHRQ CCCCCHHHCCHHHCC | 14.04 | 27017623 | |
| 97 | Phosphorylation | SPSMTSCSKEHRQGT CCCHHHCCHHHCCCC | 40.63 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TAR1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TAR1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TAR1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| COQ5_YEAST | COQ5 | physical | 18622616 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...