TAR1_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TAR1_YEAST
• UniProt AC: Q8TGM6
• Protein Name: Protein TAR1
• Gene Name: TAR1
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 124
• Subcellular Localization: Mitochondrion .
• Protein Description: May be involved in mtDNA stability or mitochondrial gene expression regulation at the post-transcriptional level..
• Protein Sequence: MRDSPTHKEQRAQNTMSDQMPFPFNNFTYFFTLFSKFFSSFHHCTCSLSVSRQYLALDGIYHPLRAAFPNNSTLRRHFTKNRTPRHTGFSPSMTSCSKEHRQGTAPKLPSPNYNSGTEGTRFQI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
90	Phosphorylation	TPRHTGFSPSMTSCS CCCCCCCCCCHHHCC	19.87	27017623
95	Phosphorylation	GFSPSMTSCSKEHRQ CCCCCHHHCCHHHCC	14.04	27017623
97	Phosphorylation	SPSMTSCSKEHRQGT CCCHHHCCHHHCCCC	40.63	27017623

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TAR1_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TAR1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TAR1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
COQ5_YEAST	COQ5	physical	18622616

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.