| UniProt ID | MSMO_YEAST | |
|---|---|---|
| UniProt AC | P53045 | |
| Protein Name | Methylsterol monooxygenase | |
| Gene Name | ERG25 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 309 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein . |
|
| Protein Description | Catalyzes the first step in the removal of the two C-4 methyl groups of 4,4-dimethylzymosterol.. | |
| Protein Sequence | MSAVFNNATLSGLVQASTYSQTLQNVAHYQPQLNFMEKYWAAWYSYMNNDVLATGLMFFLLHEFMYFFRCLPWFIIDQIPYFRRWKLQPTKIPSAKEQLYCLKSVLLSHFLVEAIPIWTFHPMCEKLGITVEVPFPSLKTMALEIGLFFVLEDTWHYWAHRLFHYGVFYKYIHKQHHRYAAPFGLSAEYAHPAETLSLGFGTVGMPILYVMYTGKLHLFTLCVWITLRLFQAVDSHSGYDFPWSLNKIMPFWAGAEHHDLHHHYFIGNYASSFRWWDYCLDTESGPEAKASREERMKKRAENNAQKKTN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 86 | Ubiquitination | IPYFRRWKLQPTKIP CCCHHCCCCCCCCCC | 35.12 | 23749301 | |
| 91 | Ubiquitination | RWKLQPTKIPSAKEQ CCCCCCCCCCCHHHH | 60.34 | 23749301 | |
| 96 | Acetylation | PTKIPSAKEQLYCLK CCCCCCHHHHHHHHH | 50.78 | 24489116 | |
| 96 | Ubiquitination | PTKIPSAKEQLYCLK CCCCCCHHHHHHHHH | 50.78 | 23749301 | |
| 103 | Ubiquitination | KEQLYCLKSVLLSHF HHHHHHHHHHHHHHH | 34.65 | 17644757 | |
| 126 | Ubiquitination | TFHPMCEKLGITVEV HHCHHHHHCCCEEEE | 47.27 | 17644757 | |
| 139 | Ubiquitination | EVPFPSLKTMALEIG EEECCCHHHHHHHHH | 40.36 | 17644757 | |
| 247 | Ubiquitination | DFPWSLNKIMPFWAG CCCCCHHHHCCCCCC | 45.75 | 17644757 | |
| 289 | Ubiquitination | TESGPEAKASREERM CCCCHHHHHHHHHHH | 45.28 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MSMO_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MSMO_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MSMO_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Ubiquitylation | |
| Reference | PubMed |
| "A subset of membrane-associated proteins is ubiquitinated in responseto mutations in the endoplasmic reticulum degradation machinery."; Hitchcock A.L., Auld K., Gygi S.P., Silver P.A.; Proc. Natl. Acad. Sci. U.S.A. 100:12735-12740(2003). Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-96, AND MASSSPECTROMETRY. | |
