UniProt ID | SHB17_YEAST | |
---|---|---|
UniProt AC | P36136 | |
Protein Name | Sedoheptulose 1,7-bisphosphatase | |
Gene Name | SHB17 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 271 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Sedoheptulose 1,7-bisphosphatase involved in riboneogenesis. Dephosphorylates sedoheptulose 1,7-bisphosphate (SBP), which is converted via the non-oxidative pentose phosphate pathway to ribose-5-phosphate. Has a fructose 1,6-bisphosphatase activity in vitro, but this is probably not biologically relevant, since deletion does not affect fructose 1,6-biphosphate (FBP) levels.. | |
Protein Sequence | MPSLTPRCIIVRHGQTEWSKSGQYTGLTDLPLTPYGEGQMLRTGESVFRNNQFLNPDNITYIFTSPRLRARQTVDLVLKPLSDEQRAKIRVVVDDDLREWEYGDYEGMLTREIIELRKSRGLDKERPWNIWRDGCENGETTQQIGLRLSRAIARIQNLHRKHQSEGRASDIMVFAHGHALRYFAAIWFGLGVQKKCETIEEIQNVKSYDDDTVPYVKLESYRHLVDNPCFLLDAGGIGVLSYAHHNIDEPALELAGPFVSPPEEESQHGDV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MPSLTPRCII -----CCCCCCCEEE | 43.51 | 21126336 | |
60 | Phosphorylation | FLNPDNITYIFTSPR CCCCCCEEEEEECCC | 19.47 | 21440633 | |
64 | Phosphorylation | DNITYIFTSPRLRAR CCEEEEEECCCCCCC | 28.41 | 22369663 | |
65 | Phosphorylation | NITYIFTSPRLRARQ CEEEEEECCCCCCCC | 9.40 | 22369663 | |
79 | Acetylation | QTVDLVLKPLSDEQR CEEEEEEECCCHHHH | 36.11 | 24489116 | |
124 | Acetylation | RKSRGLDKERPWNIW HHHCCCCCCCCCCCC | 61.74 | 24489116 | |
217 | Acetylation | DDTVPYVKLESYRHL CCCCCEEEEEHHHHH | 40.47 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SHB17_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SHB17_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SHB17_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SHB17_YEAST | SHB17 | physical | 18719252 | |
TAL1_YEAST | TAL1 | genetic | 21663798 | |
EXO84_YEAST | EXO84 | genetic | 27708008 | |
KRR1_YEAST | KRR1 | genetic | 27708008 | |
VTI1_YEAST | VTI1 | genetic | 27708008 | |
PRP6_YEAST | PRP6 | genetic | 27708008 | |
ARP2_YEAST | ARP2 | genetic | 27708008 | |
MAK21_YEAST | MAK21 | genetic | 27708008 | |
CDC37_YEAST | CDC37 | genetic | 27708008 | |
ERF3_YEAST | SUP35 | genetic | 27708008 | |
GNA1_YEAST | GNA1 | genetic | 27708008 | |
ACT_YEAST | ACT1 | genetic | 27708008 | |
RPN12_YEAST | RPN12 | genetic | 27708008 | |
RRP3_YEAST | RRP3 | genetic | 27708008 | |
IPI1_YEAST | IPI1 | genetic | 27708008 | |
FDFT_YEAST | ERG9 | genetic | 27708008 | |
STS1_YEAST | STS1 | genetic | 27708008 | |
KTHY_YEAST | CDC8 | genetic | 27708008 | |
MED14_YEAST | RGR1 | genetic | 27708008 | |
SEC13_YEAST | SEC13 | genetic | 27708008 | |
TAD3_YEAST | TAD3 | genetic | 27708008 | |
CBF3B_YEAST | CEP3 | genetic | 27708008 | |
TIM50_YEAST | TIM50 | genetic | 27708008 | |
DIB1_YEAST | DIB1 | genetic | 27708008 | |
BUR1_YEAST | SGV1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...