DIB1_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DIB1_YEAST
• UniProt AC: Q06819
• Protein Name: Spliceosomal protein DIB1
• Gene Name: DIB1
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 143
• Subcellular Localization: Nucleus.
• Protein Description: Essential role in pre-mRNA splicing. Also essential for entry into mitosis (G2/M progression) as well as for chromosome segregation during mitosis..
• Protein Sequence: MASVLLPQLRTGWHVDQAIVTETKRLVVIRFGRKNDRQCMIMDELLSSIAERVRNFAVIYLCDIDEVSDFDEMYELTDPMTVMFFYHNKHMMCDFGTGNNNKLNFIVDDKQEMIDILETIFRGARKNKGLVVSPYDYNHKRVS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MASVLLPQL ------CCCCCCHHH	14.35	22814378

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DIB1_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DIB1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DIB1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PRP6_YEAST	PRP6	physical	10688190
PRP6_YEAST	PRP6	physical	18719252
SWE1_YEAST	SWE1	physical	18719252
DIG1_YEAST	DIG1	physical	18719252
IHO1_HUMAN	CCDC36	physical	27107014
LNX1_HUMAN	LNX1	physical	27107014
BDH2_HUMAN	BDH2	physical	27107014

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.