| UniProt ID | DIG1_YEAST | |
|---|---|---|
| UniProt AC | Q03063 | |
| Protein Name | Down-regulator of invasive growth 1 | |
| Gene Name | DIG1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 452 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | DIG1 and DIG2 are negative regulators of the filamentation and pheromone induced mating program. DIG1 and DIG2 inhibit the transcriptional activity of STE12 by direct protein-protein interaction. DIG1 colocalizes to promoters with STE12 and redistributes with it during induction of filamentation (by butanol) or mating (by pheromone) to program specific genes, but binding of DIG1 to STE12 is reduced by pheromone treatment.. | |
| Protein Sequence | MAVSARLRTTAEDTSIAKSTQDPIGDTEISVANAKGSSDSNIKNSPGGNSVGQESELEHVPEEDDSGDKEADHEDSETATAKKRKAQPLKNPKKSLKRGRVPAPLNLSDSNTNTHGGNIKDGNLASSNSAHFPPVANQNVKSAPAQVTQHSKFQPRVQYLGKASSRQSIQVNNSSNSYGKPHMPSAGIMSAMNPYMPMNRYIMSPYYNPYGIPPPHMLNKPIMTPYVSYPYPMGPRTSIPYAMQGGNARPYEENEYSASNYRNKRVNDSYDSPLSGTASTGKTRRSEEGSRNSSVGSSANAGPTQQRADLRPADMIPAEEYHFERDALLSANTKARSASTSTSTSTSTNRDRSSWHEAEPNKDEEEGTDLAIEDGAVPTPTFTTFQRTSQPQQQSPSLLQGEIRLSSHIFAFEFPLSSSNVDKKMFMSICNKVWNESKELTKKSSSHHRTGK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MAVSARLRTTA ----CCCCCCCCCCH | 9.72 | 24961812 | |
| 9 | Phosphorylation | AVSARLRTTAEDTSI CCCCCCCCCHHHCCH | 34.64 | 24961812 | |
| 10 | Phosphorylation | VSARLRTTAEDTSIA CCCCCCCCHHHCCHH | 22.93 | 24961812 | |
| 14 | Phosphorylation | LRTTAEDTSIAKSTQ CCCCHHHCCHHHCCC | 17.34 | 24961812 | |
| 15 | Phosphorylation | RTTAEDTSIAKSTQD CCCHHHCCHHHCCCC | 32.63 | 24961812 | |
| 19 | Phosphorylation | EDTSIAKSTQDPIGD HHCCHHHCCCCCCCC | 23.44 | 25533186 | |
| 37 | Phosphorylation | SVANAKGSSDSNIKN EEEECCCCCCCCCCC | 30.20 | 22369663 | |
| 38 | Phosphorylation | VANAKGSSDSNIKNS EEECCCCCCCCCCCC | 54.44 | 22369663 | |
| 40 | Phosphorylation | NAKGSSDSNIKNSPG ECCCCCCCCCCCCCC | 42.26 | 22369663 | |
| 45 | Phosphorylation | SDSNIKNSPGGNSVG CCCCCCCCCCCCCCC | 21.66 | 22369663 | |
| 50 | Phosphorylation | KNSPGGNSVGQESEL CCCCCCCCCCCHHHH | 30.79 | 22369663 | |
| 55 | Phosphorylation | GNSVGQESELEHVPE CCCCCCHHHHCCCCC | 39.32 | 22369663 | |
| 66 | Phosphorylation | HVPEEDDSGDKEADH CCCCCCCCCCCCCCC | 62.30 | 22890988 | |
| 76 | Phosphorylation | KEADHEDSETATAKK CCCCCCCHHHHHHHH | 33.58 | 25521595 | |
| 78 | Phosphorylation | ADHEDSETATAKKRK CCCCCHHHHHHHHHH | 33.01 | 21551504 | |
| 108 | Phosphorylation | VPAPLNLSDSNTNTH CCCCCCCCCCCCCCC | 37.61 | 22369663 | |
| 110 | Phosphorylation | APLNLSDSNTNTHGG CCCCCCCCCCCCCCC | 42.02 | 22369663 | |
| 112 | Phosphorylation | LNLSDSNTNTHGGNI CCCCCCCCCCCCCCC | 45.50 | 22369663 | |
| 114 | Phosphorylation | LSDSNTNTHGGNIKD CCCCCCCCCCCCCCC | 21.62 | 30377154 | |
| 126 | Phosphorylation | IKDGNLASSNSAHFP CCCCCCCCCCCCCCC | 32.97 | 22369663 | |
| 127 | Phosphorylation | KDGNLASSNSAHFPP CCCCCCCCCCCCCCC | 29.24 | 22369663 | |
| 129 | Phosphorylation | GNLASSNSAHFPPVA CCCCCCCCCCCCCCC | 25.68 | 22369663 | |
| 142 | Phosphorylation | VANQNVKSAPAQVTQ CCCCCCCCCCCCHHC | 34.89 | 22369663 | |
| 148 | Phosphorylation | KSAPAQVTQHSKFQP CCCCCCHHCCCCCCC | 14.42 | 22890988 | |
| 151 | Phosphorylation | PAQVTQHSKFQPRVQ CCCHHCCCCCCCCHH | 25.91 | 22890988 | |
| 152 | Acetylation | AQVTQHSKFQPRVQY CCHHCCCCCCCCHHC | 45.99 | 24489116 | |
| 164 | Phosphorylation | VQYLGKASSRQSIQV HHCCCCCCCCCCEEE | 29.55 | 21551504 | |
| 165 | Phosphorylation | QYLGKASSRQSIQVN HCCCCCCCCCCEEEC | 38.92 | 24961812 | |
| 168 | Phosphorylation | GKASSRQSIQVNNSS CCCCCCCCEEECCCC | 17.55 | 21551504 | |
| 175 | Phosphorylation | SIQVNNSSNSYGKPH CEEECCCCCCCCCCC | 31.73 | 23749301 | |
| 177 | Phosphorylation | QVNNSSNSYGKPHMP EECCCCCCCCCCCCC | 36.89 | 21551504 | |
| 180 | Ubiquitination | NSSNSYGKPHMPSAG CCCCCCCCCCCCCHH | 24.42 | 23749301 | |
| 195 | Phosphorylation | IMSAMNPYMPMNRYI HHHHCCCCCCCCCCC | 14.62 | 23749301 | |
| 237 | Phosphorylation | PYPMGPRTSIPYAMQ CCCCCCCCCCCCHHC | 33.86 | 22369663 | |
| 238 | Phosphorylation | YPMGPRTSIPYAMQG CCCCCCCCCCCHHCC | 23.89 | 22369663 | |
| 241 | Phosphorylation | GPRTSIPYAMQGGNA CCCCCCCCHHCCCCC | 17.03 | 22369663 | |
| 251 | Phosphorylation | QGGNARPYEENEYSA CCCCCCCCCCCCCCC | 30.26 | 19779198 | |
| 256 | Phosphorylation | RPYEENEYSASNYRN CCCCCCCCCCCCCCC | 22.56 | 19779198 | |
| 257 | Phosphorylation | PYEENEYSASNYRNK CCCCCCCCCCCCCCC | 21.02 | 28132839 | |
| 269 | Phosphorylation | RNKRVNDSYDSPLSG CCCCCCCCCCCCCCC | 26.15 | 22369663 | |
| 270 | Phosphorylation | NKRVNDSYDSPLSGT CCCCCCCCCCCCCCC | 24.25 | 22890988 | |
| 272 | Phosphorylation | RVNDSYDSPLSGTAS CCCCCCCCCCCCCCC | 21.36 | 22369663 | |
| 275 | Phosphorylation | DSYDSPLSGTASTGK CCCCCCCCCCCCCCC | 37.17 | 22369663 | |
| 277 | Phosphorylation | YDSPLSGTASTGKTR CCCCCCCCCCCCCCC | 17.66 | 22369663 | |
| 279 | Phosphorylation | SPLSGTASTGKTRRS CCCCCCCCCCCCCCC | 37.21 | 22369663 | |
| 280 | Phosphorylation | PLSGTASTGKTRRSE CCCCCCCCCCCCCCC | 39.99 | 22369663 | |
| 286 | Phosphorylation | STGKTRRSEEGSRNS CCCCCCCCCCCCCCC | 36.39 | 22369663 | |
| 290 | Phosphorylation | TRRSEEGSRNSSVGS CCCCCCCCCCCCCCC | 31.41 | 22369663 | |
| 293 | Phosphorylation | SEEGSRNSSVGSSAN CCCCCCCCCCCCCCC | 25.87 | 22369663 | |
| 294 | Phosphorylation | EEGSRNSSVGSSANA CCCCCCCCCCCCCCC | 33.76 | 22369663 | |
| 297 | Phosphorylation | SRNSSVGSSANAGPT CCCCCCCCCCCCCCC | 24.91 | 22369663 | |
| 298 | Phosphorylation | RNSSVGSSANAGPTQ CCCCCCCCCCCCCCC | 21.44 | 22369663 | |
| 304 | Phosphorylation | SSANAGPTQQRADLR CCCCCCCCCCCCCCC | 36.09 | 22369663 | |
| 330 | Phosphorylation | FERDALLSANTKARS CCHHHHHHCCCCCCC | 21.96 | 22369663 | |
| 333 | Phosphorylation | DALLSANTKARSAST HHHHHCCCCCCCCCC | 26.29 | 19779198 | |
| 337 | Phosphorylation | SANTKARSASTSTST HCCCCCCCCCCCCCC | 31.28 | 22890988 | |
| 339 | Phosphorylation | NTKARSASTSTSTST CCCCCCCCCCCCCCC | 24.92 | 22890988 | |
| 340 | Phosphorylation | TKARSASTSTSTSTS CCCCCCCCCCCCCCC | 35.42 | 22890988 | |
| 341 | Phosphorylation | KARSASTSTSTSTST CCCCCCCCCCCCCCC | 20.19 | 28889911 | |
| 343 | Phosphorylation | RSASTSTSTSTSTNR CCCCCCCCCCCCCCC | 21.81 | 22890988 | |
| 344 | Phosphorylation | SASTSTSTSTSTNRD CCCCCCCCCCCCCCC | 35.79 | 22890988 | |
| 345 | Phosphorylation | ASTSTSTSTSTNRDR CCCCCCCCCCCCCCC | 21.81 | 22890988 | |
| 346 | Phosphorylation | STSTSTSTSTNRDRS CCCCCCCCCCCCCCC | 39.39 | 28889911 | |
| 347 | Phosphorylation | TSTSTSTSTNRDRSS CCCCCCCCCCCCCCC | 24.37 | 28889911 | |
| 353 | Phosphorylation | TSTNRDRSSWHEAEP CCCCCCCCCCCCCCC | 41.91 | 28132839 | |
| 354 | Phosphorylation | STNRDRSSWHEAEPN CCCCCCCCCCCCCCC | 33.09 | 22369663 | |
| 368 | Phosphorylation | NKDEEEGTDLAIEDG CCCCCCCCCCEECCC | 30.99 | 22369663 | |
| 379 | Phosphorylation | IEDGAVPTPTFTTFQ ECCCCCCCCCCCCCC | 28.50 | 22369663 | |
| 381 | Phosphorylation | DGAVPTPTFTTFQRT CCCCCCCCCCCCCCC | 35.77 | 22369663 | |
| 383 | Phosphorylation | AVPTPTFTTFQRTSQ CCCCCCCCCCCCCCC | 29.22 | 22369663 | |
| 384 | Phosphorylation | VPTPTFTTFQRTSQP CCCCCCCCCCCCCCC | 17.36 | 22369663 | |
| 388 | Phosphorylation | TFTTFQRTSQPQQQS CCCCCCCCCCCCCCC | 22.41 | 22890988 | |
| 389 | Phosphorylation | FTTFQRTSQPQQQSP CCCCCCCCCCCCCCC | 41.89 | 22890988 | |
| 395 | Phosphorylation | TSQPQQQSPSLLQGE CCCCCCCCCCHHHCE | 16.48 | 22369663 | |
| 397 | Phosphorylation | QPQQQSPSLLQGEIR CCCCCCCCHHHCEEE | 47.13 | 22369663 | |
| 406 | Phosphorylation | LQGEIRLSSHIFAFE HHCEEEECCCEEEEE | 15.26 | 19779198 | |
| 407 | Phosphorylation | QGEIRLSSHIFAFEF HCEEEECCCEEEEEC | 25.79 | 19779198 | |
| 423 | Acetylation | LSSSNVDKKMFMSIC CCCCCCCHHHHHHHH | 41.68 | 24489116 | |
| 428 | Phosphorylation | VDKKMFMSICNKVWN CCHHHHHHHHHHHHH | 16.84 | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DIG1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DIG1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DIG1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-129; SER-142; SER-238;SER-272; SER-275; THR-277; SER-279; SER-290; SER-293; SER-294;SER-330; SER-339; THR-340; THR-379; SER-389; SER-395; SER-397 ANDSER-428, AND MASS SPECTROMETRY. | |
| "Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases."; Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.; Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-129; SER-290 ANDSER-294, AND MASS SPECTROMETRY. | |
| "Large-scale phosphorylation analysis of alpha-factor-arrestedSaccharomyces cerevisiae."; Li X., Gerber S.A., Rudner A.D., Beausoleil S.A., Haas W., Villen J.,Elias J.E., Gygi S.P.; J. Proteome Res. 6:1190-1197(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-272 AND SER-275, ANDMASS SPECTROMETRY. | |
| "Quantitative phosphoproteomics applied to the yeast pheromonesignaling pathway."; Gruhler A., Olsen J.V., Mohammed S., Mortensen P., Faergeman N.J.,Mann M., Jensen O.N.; Mol. Cell. Proteomics 4:310-327(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-395, AND MASSSPECTROMETRY. | |
