| UniProt ID | KTI12_YEAST | |
|---|---|---|
| UniProt AC | P34253 | |
| Protein Name | Protein KTI12 | |
| Gene Name | KTI12 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 313 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Elongator-associated factor that is not a structural subunit but rather transiently contacts Elongator, presumably to promote its interaction with elongation competent pol II. Regulates Elongator complex gamma-toxin target (TOT) activity, resulting in G1 block by Kluyveromyces lactis toxin zymocin (pGKL1 killer toxin), probably through regulation of the Elongator IKI3 subunit phosphorylation state. Required for an early step in synthesis of 5-methoxycarbonylmethyl (mcm5) and 5-carbamoylmethyl (ncm5) groups present on uridines at the wobble position in tRNA.. | |
| Protein Sequence | MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGIKHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCEVKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSSNRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQKPNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVIVSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRIGPLFADYLNKNLN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 32 | Phosphorylation | LQSKIDATPSLSKYS HHHCCCCCCCCCCEE | 15.06 | 19795423 | |
| 34 | Phosphorylation | SKIDATPSLSKYSIT HCCCCCCCCCCEEEE | 40.70 | 19823750 | |
| 36 | Phosphorylation | IDATPSLSKYSITYH CCCCCCCCCEEEEEE | 33.61 | 19823750 | |
| 188 | Phosphorylation | TSKSAKNSGHNDPLS CCHHHCCCCCCCCHH | 40.50 | 27017623 | |
| 195 | Phosphorylation | SGHNDPLSKGLQKPN CCCCCCHHHCCCCCC | 30.02 | 27017623 | |
| 203 | Phosphorylation | KGLQKPNSATVLKPA HCCCCCCCCEEECCC | 33.57 | 22369663 | |
| 205 | Phosphorylation | LQKPNSATVLKPASQ CCCCCCCEEECCCCC | 26.62 | 22369663 | |
| 211 | Phosphorylation | ATVLKPASQSNFIQV CEEECCCCCCCCEEE | 42.54 | 22369663 | |
| 213 | Phosphorylation | VLKPASQSNFIQVLD EECCCCCCCCEEEEE | 31.08 | 22369663 | |
| 223 | Phosphorylation | IQVLDIETSKIIKTI EEEEEHHHHHHHHHH | 35.34 | 22369663 | |
| 224 | Phosphorylation | QVLDIETSKIIKTIM EEEEHHHHHHHHHHH | 14.74 | 22369663 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KTI12_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KTI12_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KTI12_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
