| UniProt ID | GET1_YEAST | |
|---|---|---|
| UniProt AC | P53192 | |
| Protein Name | Golgi to ER traffic protein 1 {ECO:0000255|HAMAP-Rule:MF_03113} | |
| Gene Name | GET1 {ECO:0000255|HAMAP-Rule:MF_03113} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 235 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein. Golgi apparatus membrane Multi-pass membrane protein. |
|
| Protein Description | Required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Together with GET2, acts as a membrane receptor for soluble GET3, which recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. The GET complex cooperates with the HDEL receptor ERD2 to mediate the ATP-dependent retrieval of resident ER proteins that contain a C-terminal H-D-E-L retention signal from the Golgi to the ER. Involved in mitochondrial distribution and morphology.. | |
| Protein Sequence | MHWAAAVAIFFIVVTKFLQYTNKYHEKWISKFAPGNELSKKYLAKVKERHELKEFNNSISAQDNYAKWTKNNRKLDSLDKEINNLKDEIQSENKAFQAHLHKLRLLALTVPFFVFKIMYGKTPVYKLSSSTSTLFPTFVSGVWSQGWLYVLLHPLRTISQKWHIMEGKFGASKFDDMALQSVSLGIWVWALMNVINGVEFIVKQLFLTPKMEAPASVETQEEKALDAVDDAIILD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 31 | Acetylation | YHEKWISKFAPGNEL HHHHHHHHCCCCCHH | 36.09 | 24489116 | |
| 53 | Acetylation | VKERHELKEFNNSIS HHHHHHHHHHHHCCC | 58.22 | 24489116 | |
| 58 | Phosphorylation | ELKEFNNSISAQDNY HHHHHHHCCCHHHHH | 21.01 | 27017623 | |
| 60 | Phosphorylation | KEFNNSISAQDNYAK HHHHHCCCHHHHHHH | 21.50 | 27017623 | |
| 67 | Acetylation | SAQDNYAKWTKNNRK CHHHHHHHHHHCHHH | 45.06 | 24489116 | |
| 86 | Succinylation | DKEINNLKDEIQSEN HHHHHHHHHHHHHCC | 56.28 | 23954790 | |
| 161 | Acetylation | PLRTISQKWHIMEGK HHHHHHHHHHHHCCC | 33.67 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GET1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GET1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GET1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
