| UniProt ID | YPD1_YEAST | |
|---|---|---|
| UniProt AC | Q07688 | |
| Protein Name | Phosphorelay intermediate protein YPD1 | |
| Gene Name | YPD1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 167 | |
| Subcellular Localization | Cytoplasm. Nucleus. Localizes constitutively to the cytoplasm and the nucleus, independent on osmotic conditions and phosphorylation status of the protein. | |
| Protein Description | Phosphorelay intermediate protein that is part of the branched SLN1-YPD1-SKN7/SSK1 two-component regulatory system, which controls activity of the HOG1 pathway and gene expression in response to changes in the osmolarity of the extracellular environment. Catalyzes the phosphoryl group transfer from the membrane-bound osmosensing histidine kinase SLN1 to two distinct response regulator proteins, SSK1 in the cytoplasm, and transcription factor SKN7 in the nucleus.. | |
| Protein Sequence | MSTIPSEIINWTILNEIISMDDDDSDFSKGLIIQFIDQAQTTFAQMQRQLDGEKNLTELDNLGHFLKGSSAALGLQRIAWVCERIQNLGRKMEHFFPNKTELVNTLSDKSIINGINIDEDDEEIKIQVDDKDENSIYLILIAKALNQSRLEFKLARIELSKYYNTNL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 54 | Acetylation | QRQLDGEKNLTELDN HHHHCCCCCCHHHHH | 63.89 | 24489116 | |
| 64 | Phosphorylation | TELDNLGHFLKGSSA HHHHHHHHHHHHHHH | 28.21 | 8808622 | |
| 99 | Acetylation | MEHFFPNKTELVNTL HHHHCCCCHHHHHCC | 43.55 | 24489116 | |
| 153 | Acetylation | NQSRLEFKLARIELS CCCCHHHHHHHHHHH | 31.68 | 24489116 | |
| 161 | Ubiquitination | LARIELSKYYNTNL- HHHHHHHHHHCCCC- | 65.46 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YPD1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YPD1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YPD1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Yeast HOG1 MAP kinase cascade is regulated by a multistepphosphorelay mechanism in the SLN1-YPD1-SSK1 two-componentosmosensor."; Posas F., Wurgler-Murphy S.M., Maeda T., Witten E.A., Thai T.C.,Saito H.; Cell 86:865-875(1996). Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], MUTAGENESIS OF HIS-64,PHOSPHORYLATION AT HIS-64, AND INTERACTION WITH SLN1 AND SSK1. | |
