| UniProt ID | ATG17_YEAST | |
|---|---|---|
| UniProt AC | Q06410 | |
| Protein Name | Autophagy-related protein 17 | |
| Gene Name | ATG17 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 417 | |
| Subcellular Localization |
Cytoplasm. Preautophagosomal structure membrane Peripheral membrane protein. |
|
| Protein Description | Autophagy-specific protein that functions with ATG13, ATG29, and CIS1/ATG31 in response to autophagy-inducing signals as a scaffold to recruit other ATG proteins to organize pre-autophagosomal structure (PAS) formation. Modulates the timing and magnitude of the autophagy response, such as the size of the sequestering vesicles, through interacting with and regulating ATG1 kinase activity. Plays particularly a role in pexophagy and nucleophagy. With ATG13, is required for ATG1 activation by autophosphorylation of 'Thr-226'. Recruits ATG9 to the pre-autophagosomal structure. Plays also a role in regulation of filamentous growth.. | |
| Protein Sequence | MNEADVTKFVNNARKTLTDAQLLCSSANLRIVDIKKKLSSWQLSISKLNFLIVGLRQQGKFLYTILKEGIGTKLIQKQWNQAVLVVLVDEMKYWQYEITSKVQRLDGIVNELSISEKDDTDPSKLGDYISRDNVNLLNDKLKEVPVIERQIENIKLQYENMVRKVNKELIDTKLTDVTQKFQSKFGIDNLMETNVAEQFSRELTDLEKDLAEIMNSLTQHFDKTLLLQDKKIDNDEREELFKVVQGDDKELYNIFKTLHEVIDDVDKTILNLGQFLQAKIKEKTELHSEVSEIINDFNRNLEYLLIFKDISNLIDSFKNSCTQDIQTTKELCEFYDNFEESYGNLVLEAKRRKDVANRMKTILKDCEKQLQNLDAQDQEERQNFIAENGTYLPETIWPGKIDDFSSLYTLNYNVKNP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 16 | Phosphorylation | FVNNARKTLTDAQLL HHHHHHHHHHHHHHH | 29.36 | 19779198 | |
| 18 | Phosphorylation | NNARKTLTDAQLLCS HHHHHHHHHHHHHHH | 34.22 | 19779198 | |
| 230 | Acetylation | KTLLLQDKKIDNDER HHHHHCCCCCCCHHH | 38.37 | 25381059 | |
| 405 | Phosphorylation | PGKIDDFSSLYTLNY CCCCCCCHHCEEEEC | 26.82 | 17287358 | |
| 406 | Phosphorylation | GKIDDFSSLYTLNYN CCCCCCHHCEEEECC | 25.95 | 17287358 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATG17_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATG17_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATG17_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Analysis of phosphorylation sites on proteins from Saccharomycescerevisiae by electron transfer dissociation (ETD) massspectrometry."; Chi A., Huttenhower C., Geer L.Y., Coon J.J., Syka J.E.P., Bai D.L.,Shabanowitz J., Burke D.J., Troyanskaya O.G., Hunt D.F.; Proc. Natl. Acad. Sci. U.S.A. 104:2193-2198(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-405 AND SER-406, ANDMASS SPECTROMETRY. | |
